DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment woc and ZMYM1

DIOPT Version :9

Sequence 1:NP_001097946.1 Gene:woc / 47249 FlyBaseID:FBgn0010328 Length:1703 Species:Drosophila melanogaster
Sequence 2:XP_024305590.1 Gene:ZMYM1 / 79830 HGNCID:26253 Length:1193 Species:Homo sapiens


Alignment Length:320 Identity:77/320 - (24%)
Similarity:119/320 - (37%) Gaps:57/320 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   709 QFCCAGCLNTFKKG--------------------------------LKTCSCCQKDISGGQEGFL 741
            |..||||....:||                                .:|||.|.|||...::...
Human   137 QVSCAGCKKILQKGQTAYQRKGSAQLFCSIPCITEYISSASSPVPSKRTCSNCSKDILNPKDVIS 201

  Fly   742 APVGDKDQFKDFCSQSCLRRYESMCNPRRKLRTD----VCGVCNNQKPVRVEMLLEDREHYFCSN 802
            ..:.|....|.|||.|||..||....|...:.|:    .|.:|.....::.|:..::.:|..|||
Human   202 VQLEDTTSCKTFCSLSCLSSYEEKRKPFVTICTNSILTKCSMCQKTAIIQYEVKYQNVKHNLCSN 266

  Fly   803 PCFSAFKFVSNVNADPCAMCSKYFERRSAESYTIYNEQQSPKVFCSRVCINVYIIVNRHIVSCQW 867
            .|.|.|...:|...:.|..|..|....|:.|:.:..|.|| ..|.|...|..|.......:....
Human   267 ACLSKFHSANNFIMNCCENCGTYCYTSSSLSHILQMEGQS-HYFNSSKSITAYKQKPAKPLISVP 330

  Fly   868 CKVKKYNFDMIYQIGGPHDQETLTCSINCLTMHG----VSCNISARAVTKCDNCSNFNTPQYHLT 928
            ||..|.:.:|| :......:..|.|||||.:.:.    .|.::|..:|.. |..:...:|:...|
Human   331 CKPLKPSDEMI-ETTSDLGKTELFCSINCFSAYSKAKMESSSVSVVSVVH-DTSTELLSPKKDTT 393

  Fly   929 MSDASMRNFCTYQCVMQFQNQ----------FARAPLTLD----SDLPPSSAGSSKSQQQ 974
            ...:::.:.......:...|.          .|.|.:.:|    |...||:|.:|.|.:|
Human   394 PVISNIVSLADTDVALPIMNTDVLQDTVSSVTATADVIVDLSKSSPSEPSNAVASSSTEQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wocNP_001097946.1 TRASH 684..721 CDD:214799 5/11 (45%)
zf-FCS 724..762 CDD:283998 15/37 (41%)
DUF3504 1531..1690 CDD:288835
ZMYM1XP_024305590.1 zf-FCS 182..222 CDD:310814 15/39 (38%)
ZnF_TTF 503..582 CDD:214739
DUF4371 544..778 CDD:316782
Dimer_Tnp_hAT 1080..1169 CDD:310361
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266757at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.