DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and YSP3

DIOPT Version :9

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:NP_014645.1 Gene:YSP3 / 854164 SGDID:S000005529 Length:478 Species:Saccharomyces cerevisiae


Alignment Length:265 Identity:62/265 - (23%)
Similarity:104/265 - (39%) Gaps:73/265 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 GKGVVVTILDDGLESDHPDIQDNYDPKASYDVNSHDDDPMPHYDMTDSNRHGTRCAGEVAATANN 427
            ||||...:||.|::::|.|.:...:..|....|.         :.:|.|.|||.|||.:.:.   
Yeast   204 GKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPAND---------EASDLNGHGTHCAGIIGSK--- 256

  Fly   428 SFCAVGIAYGASVGGVRML----DGDVTDAVEARSLSLNPQHIDIYSASWGPDDDGKTVD---GP 485
               ..|:|....:..|::|    :|.|:|.::.... :..:||: .|.....:..|.|.:   |.
Yeast   257 ---HFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEY-VTKEHIE-SSKKKNKEFKGSTANLSLGS 316

  Fly   486 G-----ELASRAFIEGTTKGRGGKGSIFIWASGNGGREQDNCNCDGYTNSIWTLSISSATEEGHV 545
            .     |:|..|.::        .|..|..|:||  .::|.|             :||       
Yeast   317 SKSLAMEMAVNAAVD--------SGVHFAIAAGN--EDEDAC-------------LSS------- 351

  Fly   546 PWYSEKCSSTLATTYSSG--------------GQGEKQVVTTDLHHSCTVSHTGTSASAPLAAGI 596
            |..:||..:..|:|:|..              ..|...:.|.....:.|:|.:|||.::|..|||
Yeast   352 PAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGI 416

  Fly   597 AALVL 601
            .:..|
Yeast   417 LSYFL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 332..621 CDD:173789 62/265 (23%)
Peptidase_S8 363..646 CDD:278510 62/265 (23%)
P_proprotein 701..787 CDD:279782
FU 1320..>1350 CDD:214589
YSP3NP_014645.1 Inhibitor_I9 70..167 CDD:283552
AprE 79..>434 CDD:224322 62/265 (23%)
Peptidases_S8_PCSK9_ProteinaseK_like 178..451 CDD:173790 62/265 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.