DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and Rspo2

DIOPT Version :9

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:XP_008763676.2 Gene:Rspo2 / 500863 RGDID:1562331 Length:250 Species:Rattus norvegicus


Alignment Length:143 Identity:27/143 - (18%)
Similarity:48/143 - (33%) Gaps:36/143 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1220 NTAACLKWSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDK------------------------- 1259
            |..:|  :|...|.:|....|:...:|:|.||....|||:                         
  Rat   107 NCDSC--FSKDFCTKCKAGFYLHRGRCFDECPEGFAPLDETMECVEGCEVGHWSEWGTCSRNNRT 169

  Fly  1260 --FQAEEDEQDDEVTRGPVN-----PYSSSPMDHSLLMSNSLDDKQDPLQAEDR--RRRSSLTQL 1315
              |:...:.:..::.:.|..     |..:......:.|.:....|:.|...|.|  ::|..|.:.
  Rat   170 CGFKWGLETRTRQIVKKPAKDTIPCPTIAESRRCKMAMRHCPGGKRTPKAKEKRNKKKRRKLIER 234

  Fly  1316 VEVPSRVCAACDR 1328
            .:....|..|.||
  Rat   235 AQEQHSVFLATDR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 332..621 CDD:173789
Peptidase_S8 363..646 CDD:278510
P_proprotein 701..787 CDD:279782
FU 1320..>1350 CDD:214589 4/9 (44%)
Rspo2XP_008763676.2 Furin-like_2 47..148 CDD:406362 13/42 (31%)
TSP1_spondin 152..205 CDD:408798 3/52 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1404
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.