DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fur1 and RSPO2

DIOPT Version :9

Sequence 1:	NP_001262954.1	Gene:	Fur1 / 47220	FlyBaseID:	FBgn0004509	Length:	1478	Species:	Drosophila melanogaster
Sequence 2:	XP_011515320.1	Gene:	RSPO2 / 340419	HGNCID:	28583	Length:	250	Species:	Homo sapiens

Alignment Length:	145	Identity:	27/145 - (18%)
Similarity:	53/145 - (36%)	Gaps:	38/145 - (26%)

- Green bases have known domain annotations that are detailed below.

  Fly  1220 NTAACLKWSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDK------------------------- 1259
            |..:|  :|...|.:|....|:...:|:|.||....||::
Human   107 NCDSC--FSKDFCTKCKVGFYLHRGRCFDECPDGFAPLEETMECVEGCEVGHWSEWGTCSRNNRT 169

  Fly  1260 --FQAEEDEQDDEVTRGPVN-----PYSSSPMDHSLLMSNSLDDKQDPLQAEDRRRRSSLTQLVE 1317
              |:...:.:..::.:.||.     |..:......:.|.:....|:.| :|:::|.:....:|:|
Human   170 CGFKWGLETRTRQIVKKPVKDTILCPTIAESRRCKMTMRHCPGGKRTP-KAKEKRNKKKKRKLIE 233

  Fly  1318 VPSR---VCAACDRS 1329
            ....   |..|.||:
Human   234 RAQEQHSVFLATDRA 248

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fur1	NP_001262954.1	S8_pro-domain	234..309	CDD:293079
		Peptidases_S8_Protein_convertases_Kexins_Fur in-like	332..621	CDD:173789
		Peptidase_S8	363..646	CDD:278510
		P_proprotein	701..787	CDD:279782
		FU	1320..>1350	CDD:214589	4/13 (31%)
RSPO2	XP_011515320.1	Furin-like_2	47..151	CDD:292535	12/45 (27%)
RSPO2	XP_011515320.1	FU	106..149	CDD:238021	12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1404
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900