DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Fur1 and Rspo4

DIOPT Version :9

Sequence 1:	NP_001262954.1	Gene:	Fur1 / 47220	FlyBaseID:	FBgn0004509	Length:	1478	Species:	Drosophila melanogaster
Sequence 2:	NP_001035779.1	Gene:	Rspo4 / 228770	MGIID:	1924467	Length:	228	Species:	Mus musculus

Alignment Length:	86	Identity:	20/86 - (23%)
Similarity:	36/86 - (41%)	Gaps:	14/86 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly  1209 VGEVGMTRDHSNT-----AACLK-WSDRKCLECNDSAYMFEDQCYDVCPVHTYPLDKFQAEEDEQ 1267
            :|..|:....:|.     |.|.. :|...|:.|....::::.:|...||..|  |......|.::
Mouse    75 LGFFGIRGQEANRCKKCGATCESCFSQDFCIRCKRRFHLYKGKCLPSCPPGT--LTHQSTRECQE 137

  Fly  1268 DDEVTRGPVNPYSS-SPMDHS 1287
            :.|     .:|:.| ||..|:
Mouse   138 ECE-----PSPWGSWSPCIHN 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Fur1	NP_001262954.1	S8_pro-domain	234..309	CDD:293079
		Peptidases_S8_Protein_convertases_Kexins_Fur in-like	332..621	CDD:173789
		Peptidase_S8	363..646	CDD:278510
		P_proprotein	701..787	CDD:279782
		FU	1320..>1350	CDD:214589
Rspo4	NP_001035779.1	Furin-like_2	35..138	CDD:292535	14/64 (22%)
		FU	85..128		10/44 (23%)
		FU	85..126	CDD:214589	9/40 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	193..228
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1404
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900