DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fur1 and LOC100330575

DIOPT Version :9

Sequence 1:NP_001262954.1 Gene:Fur1 / 47220 FlyBaseID:FBgn0004509 Length:1478 Species:Drosophila melanogaster
Sequence 2:XP_002666956.3 Gene:LOC100330575 / 100330575 -ID:- Length:983 Species:Danio rerio


Alignment Length:133 Identity:34/133 - (25%)
Similarity:52/133 - (39%) Gaps:15/133 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1228 SDRKCLECNDSAYMFEDQCYDVCPVHTY-PLDKFQAEEDEQDDEVTRGPVNPYSSSPMDHSLLMS 1291
            |:..||.|....::....|...||..:| .:..::.:...:.....|||      .|.|.. ..|
Zfish   213 SESLCLTCQTGYFLNNGTCVKECPAGSYKDVRGWRCQACHRSCLSCRGP------GPRDCE-RCS 270

  Fly  1292 NSLDDKQDPLQAEDRRRRSSLTQLVEVPSRVCAACDRSCLECYGALASQCSTCSPGSQLRKILNE 1356
            .|:    .||..:.........|.::..||.|..||.||..|:|..|..|.:|:.|..|.:   |
Zfish   271 GSI----RPLYGKCPLISCPPGQYLDGESRSCRYCDVSCSTCFGPAAQNCISCASGFMLEQ---E 328

  Fly  1357 TFC 1359
            :.|
Zfish   329 SVC 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fur1NP_001262954.1 S8_pro-domain 234..309 CDD:293079
Peptidases_S8_Protein_convertases_Kexins_Fur in-like 332..621 CDD:173789
Peptidase_S8 363..646 CDD:278510
P_proprotein 701..787 CDD:279782
FU 1320..>1350 CDD:214589 13/29 (45%)
LOC100330575XP_002666956.3 GF_recep_IV 258..355 CDD:291509 26/88 (30%)
FU 301..349 CDD:238021 13/34 (38%)
Furin-like_2 <327..390 CDD:292535 2/8 (25%)
FU 494..542 CDD:238021
FU 595..637 CDD:214589
GF_recep_IV 599..717 CDD:291509
FU 651..693 CDD:214589
FU 698..742 CDD:214589
FU 745..789 CDD:214589
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D311719at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.