DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and AT2G36160

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_181158.1 Gene:AT2G36160 / 818188 AraportID:AT2G36160 Length:150 Species:Arabidopsis thaliana


Alignment Length:151 Identity:125/151 - (82%)
Similarity:138/151 - (91%) Gaps:1/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65
            |:.||.|..|.:| |.|||.||:||.||||.||:|||||||:||||||||||:.|:|||||||||
plant     1 MSKRKTKEPKVDV-VTLGPSVREGEQVFGVVHIFASFNDTFIHVTDLSGRETLVRITGGMKVKAD 64

  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130
            |||:|||||||||||||::||.|||||:|:|||||||||||||||||||||||||||.|||||||
plant    65 RDESSPYAAMLAAQDVAQRCKELGITAMHVKLRATGGNKTKTPGPGAQSALRALARSGMKIGRIE 129

  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151
            ||||||:||||||||||||||
plant   130 DVTPIPTDSTRRKGGRRGRRL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 112/138 (81%)
AT2G36160NP_181158.1 PTZ00129 1..139 CDD:185465 112/138 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 220 1.000 Domainoid score I720
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 252 1.000 Inparanoid score I1023
OMA 1 1.010 - - QHG62207
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - mtm1171
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.