DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and rps1402

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_595737.1 Gene:rps1402 / 5802781 PomBaseID:SPBC18H10.13 Length:139 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:112/135 - (82%)
Similarity:126/135 - (93%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDV 81
            :|||:|.||:|||||||:|||||||||:|||:|:|||.|||||||||.||||:|||||||||||.
pombe     5 VGPQIRSGELVFGVAHIFASFNDTFVHITDLTGKETIVRVTGGMKVKTDRDESSPYAAMLAAQDA 69

  Fly    82 AEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGR 146
            |.|||.:||||||||:|||||..|||||||||:|||||||:.|:|||||||||||:|||||||||
pombe    70 AAKCKEVGITALHIKIRATGGTATKTPGPGAQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGR 134

  Fly   147 RGRRL 151
            |||||
pombe   135 RGRRL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 99/122 (81%)
rps1402NP_595737.1 Ribosomal_S11 2..128 CDD:294237 99/122 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 208 1.000 Domainoid score I614
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I837
OMA 1 1.010 - - QHG62207
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - mtm9318
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1071
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.