DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and mrps11

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001038262.1 Gene:mrps11 / 556272 ZFINID:ZDB-GENE-040724-84 Length:199 Species:Danio rerio


Alignment Length:118 Identity:33/118 - (27%)
Similarity:62/118 - (52%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALH 94
            :||:.|::|:|.:.|||.:| :.:.|.:.|.:...:..:::|.||..|....|.|.:..|:|.:.
Zfish    90 IAHVKATYNNTHIQVTDCAG-QYMVRTSCGTEGFKNVKKSTPIAAQTAGISAAAKARAKGVTYVR 153

  Fly    95 IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRR 147
            :.::..        |||..||::.|....:::..|.|.||:|.:..|.:..||
Zfish   154 VLVKGL--------GPGRFSAIKGLTMGGLEVVSITDNTPVPHNGCRPRKARR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 30/109 (28%)
mrps11NP_001038262.1 Ribosomal_S11 83..198 CDD:294237 31/116 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.