DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and RpS14a

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster


Alignment Length:151 Identity:151/151 - (100%)
Similarity:151/151 - (100%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65

  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130

  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151
            |||||||||||||||||||||
  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 138/138 (100%)
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 138/138 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Homologene 1 1.000 - - H137845
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - P PTHR11759
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.