DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and mrps-11

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_506131.1 Gene:mrps-11 / 179711 WormBaseID:WBGene00012244 Length:208 Species:Caenorhabditis elegans


Alignment Length:121 Identity:27/121 - (22%)
Similarity:48/121 - (39%) Gaps:15/121 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VAHIYASFNDTFVHVTDLSGR---ETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGIT 91
            :.:|.||.|:|.|.|.|....   .|..|:.|....:.....|.....:.|.|.:..:    ||.
 Worm    99 LVYIRASKNNTLVTVMDNKNEVITSTSCRLEGFKNARKKTTIAGQTTGVAAGQRLVRR----GIR 159

  Fly    92 ALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRR 147
            .:.::::..        |||..:.::.|..:.:.:..|.|.||:.....|.:..||
 Worm   160 TVRVQVKGL--------GPGRMTCVKGLTVAGVHVVSISDHTPLCELGPRPRKIRR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 24/112 (21%)
mrps-11NP_506131.1 Ribosomal_S11 100..208 CDD:294237 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.