DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14b and LOC100911847

DIOPT Version :9

Sequence 1:NP_001284995.1 Gene:RpS14b / 47219 FlyBaseID:FBgn0004404 Length:151 Species:Drosophila melanogaster
Sequence 2:XP_003750078.4 Gene:LOC100911847 / 100911847 RGDID:6490698 Length:165 Species:Rattus norvegicus


Alignment Length:151 Identity:131/151 - (86%)
Similarity:140/151 - (92%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65
            |||||.|.:|||..:.|||||.:||.||||.||:|||||||||||||||:|||.|||||||||||
  Rat    15 MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKAD 79

  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130
            |||:|||||||||||||::||.||||||||||||||||:||||||||||||||||||.|||||||
  Rat    80 RDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIE 144

  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151
            |||||||||||||||||||||
  Rat   145 DVTPIPSDSTRRKGGRRGRRL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14bNP_001284995.1 PTZ00129 1..140 CDD:185465 118/138 (86%)
LOC100911847XP_003750078.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H137845
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.