DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and MRPS18

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_014093.1 Gene:MRPS18 / 855410 SGDID:S000005250 Length:217 Species:Saccharomyces cerevisiae


Alignment Length:127 Identity:34/127 - (26%)
Similarity:55/127 - (43%) Gaps:27/127 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 SFNDTFVHVTDLSGRETIARVTG--GMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALHIKLR 98
            ::|||.::..:|..:..|:..||  |.: ||.|.|..  ||...:..:.|..|...:....|:: 
Yeast   107 TYNDTMLYYLNLPQKVKISLSTGCLGFR-KAARGEYE--AAFQTSGRMFELIKEKNMLNKDIEV- 167

  Fly    99 ATGGNKTKTPGPGAQSALRALARSSMKIGR-----IEDVTPIPSDSTRRK-GGRRG---RRL 151
                 .....|.|..:.:.||      :|:     ::.|..| ||:|:.| ||.|.   |||
Yeast   168 -----VMDDFGKGRAAFISAL------VGKEGASVVKKVVKI-SDATKLKFGGVRSPKMRRL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 26/110 (24%)
MRPS18NP_014093.1 Ribosomal_S11 107..215 CDD:320911 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.