DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and RPS14A

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_009960.2 Gene:RPS14A / 850397 SGDID:S000000627 Length:137 Species:Saccharomyces cerevisiae


Alignment Length:132 Identity:110/132 - (83%)
Similarity:122/132 - (92%) Gaps:0/132 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 QVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEK 84
            |.||...|||||.|||||||||||||||||:||||||||||||||||||:|||||||||||||.|
Yeast     6 QARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAK 70

  Fly    85 CKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRRGR 149
            ||.:||||:|:|:|||||.:|||||||.|:||||||||.::|||||||||:||||||:|||||||
Yeast    71 CKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGR 135

  Fly   150 RL 151
            ||
Yeast   136 RL 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 98/119 (82%)
RPS14ANP_009960.2 PTZ00129 6..126 CDD:185465 98/119 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157342046
Domainoid 1 1.000 211 1.000 Domainoid score I498
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I742
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62207
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - mtm9253
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1071
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.