DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and Mrps11

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_080774.2 Gene:Mrps11 / 67994 MGIID:1915244 Length:191 Species:Mus musculus


Alignment Length:118 Identity:34/118 - (28%)
Similarity:58/118 - (49%) Gaps:9/118 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALH 94
            :|||.|::|:|.:.|...: ..::||.:.|.:...:..:.:..||..|....|.|....|:|  |
Mouse    82 IAHIKATYNNTQIQVVSAT-NASLARASCGTEGFRNAKKGTGIAAQTAGIAAAAKATGKGVT--H 143

  Fly    95 IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGRR 147
            |::...|      .|||..||::.|....:::..|.|.||:|.:..|.:..||
Mouse   144 IRVVVKG------MGPGRWSAIKGLTMGGLEVISITDNTPVPHNGCRPRKARR 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 31/109 (28%)
Mrps11NP_080774.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..62
Ribosomal_S11 82..190 CDD:294237 32/116 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.