DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and rps1402

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_595737.1 Gene:rps1402 / 5802781 PomBaseID:SPBC18H10.13 Length:139 Species:Schizosaccharomyces pombe


Alignment Length:135 Identity:112/135 - (82%)
Similarity:126/135 - (93%) Gaps:0/135 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDV 81
            :|||:|.||:|||||||:|||||||||:|||:|:|||.|||||||||.||||:|||||||||||.
pombe     5 VGPQIRSGELVFGVAHIFASFNDTFVHITDLTGKETIVRVTGGMKVKTDRDESSPYAAMLAAQDA 69

  Fly    82 AEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGR 146
            |.|||.:||||||||:|||||..|||||||||:|||||||:.|:|||||||||||:|||||||||
pombe    70 AAKCKEVGITALHIKIRATGGTATKTPGPGAQAALRALARAGMRIGRIEDVTPIPTDSTRRKGGR 134

  Fly   147 RGRRL 151
            |||||
pombe   135 RGRRL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 99/122 (81%)
rps1402NP_595737.1 Ribosomal_S11 2..128 CDD:294237 99/122 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.860

Return to query results.
Submit another query.