DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and rps14

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001016722.1 Gene:rps14 / 549476 XenbaseID:XB-GENE-6258197 Length:151 Species:Xenopus tropicalis


Alignment Length:151 Identity:131/151 - (86%)
Similarity:140/151 - (92%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65
            |||||.|.:|||..:.|||||.:||.||||.||:|||||||||||||||:|||.|||||||||||
 Frog     1 MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKAD 65

  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130
            |||:|||||||||||||::||.||||||||||||||||:||||||||||||||||||.|||||||
 Frog    66 RDESSPYAAMLAAQDVAQRCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIE 130

  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151
            |||||||||||||||||||||
 Frog   131 DVTPIPSDSTRRKGGRRGRRL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 118/138 (86%)
rps14NP_001016722.1 PTZ00129 1..140 CDD:185465 118/138 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 222 1.000 Domainoid score I2537
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 264 1.000 Inparanoid score I2989
OMA 1 1.010 - - QHG62207
OrthoDB 1 1.010 - - D1408000at2759
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - otm49278
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.