DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and mRpS11

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_524382.1 Gene:mRpS11 / 42061 FlyBaseID:FBgn0038474 Length:200 Species:Drosophila melanogaster


Alignment Length:117 Identity:32/117 - (27%)
Similarity:50/117 - (42%) Gaps:9/117 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKADRDEASPYAAMLAAQDVAEKCKTLGITALH 94
            :.:|..|.|:|.:.|||..|...:.|..|....|..| :.:..||...|..::.|...||...:.
  Fly    91 ICNIRVSPNNTIISVTDHKGVLRLIRSCGIEGFKNTR-KGTNIAAQATAVTISGKAIELGWKTVR 154

  Fly    95 IKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIEDVTPIPSDSTRRKGGR 146
            :|:|..        |||..||::.|....:.|..|.|.|.:..:..|.:..|
  Fly   155 VKVRGL--------GPGRMSAIKGLQMGGLNIVSITDNTHVSFNPPRPRKQR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 30/109 (28%)
mRpS11NP_524382.1 Ribosomal_S11 91..198 CDD:294237 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0100
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - P PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.