DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and rps14

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_956320.1 Gene:rps14 / 336687 ZFINID:ZDB-GENE-030131-8631 Length:151 Species:Danio rerio


Alignment Length:151 Identity:132/151 - (87%)
Similarity:140/151 - (92%) Gaps:0/151 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPRKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKAD 65
            |||||.|.:|||..:.|||||.:||.||||.||:|||||||||||||||:|||.|||||||||||
Zfish     1 MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKAD 65

  Fly    66 RDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRIE 130
            |||:|||||||||||||:|||.||||||||||||||||:||||||||||||||||||.|||||||
Zfish    66 RDESSPYAAMLAAQDVAQKCKELGITALHIKLRATGGNRTKTPGPGAQSALRALARSGMKIGRIE 130

  Fly   131 DVTPIPSDSTRRKGGRRGRRL 151
            |||||||||||||||||||||
Zfish   131 DVTPIPSDSTRRKGGRRGRRL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 119/138 (86%)
rps14NP_956320.1 PTZ00129 1..140 CDD:185465 119/138 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576284
Domainoid 1 1.000 223 1.000 Domainoid score I2504
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H137845
Inparanoid 1 1.050 265 1.000 Inparanoid score I3042
OMA 1 1.010 - - QHG62207
OrthoDB 1 1.010 - - D1408000at2759
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - otm26376
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1071
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.770

Return to query results.
Submit another query.