DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS14a and rps-14

DIOPT Version :9

Sequence 1:NP_524884.1 Gene:RpS14a / 47218 FlyBaseID:FBgn0004403 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_498572.1 Gene:rps-14 / 176006 WormBaseID:WBGene00004483 Length:152 Species:Caenorhabditis elegans


Alignment Length:152 Identity:124/152 - (81%)
Similarity:139/152 - (91%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAP-RKAKVQKEEVQVQLGPQVRDGEIVFGVAHIYASFNDTFVHVTDLSGRETIARVTGGMKVKA 64
            ||| ||.|.::|:..|.||||.::||::||||||:|||||||||:||:||||||.||||||||||
 Worm     1 MAPARKGKAKEEQAVVSLGPQAKEGELIFGVAHIFASFNDTFVHITDISGRETIVRVTGGMKVKA 65

  Fly    65 DRDEASPYAAMLAAQDVAEKCKTLGITALHIKLRATGGNKTKTPGPGAQSALRALARSSMKIGRI 129
            ||||:|||||||||||||::||.|||.|||||||||||.:|||||||||||||||||:.||||||
 Worm    66 DRDESSPYAAMLAAQDVADRCKQLGINALHIKLRATGGTRTKTPGPGAQSALRALARAGMKIGRI 130

  Fly   130 EDVTPIPSDSTRRKGGRRGRRL 151
            |||||||||.||||||||||||
 Worm   131 EDVTPIPSDCTRRKGGRRGRRL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS14aNP_524884.1 PTZ00129 1..140 CDD:185465 112/139 (81%)
rps-14NP_498572.1 PTZ00129 2..141 CDD:185465 111/138 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157571
Domainoid 1 1.000 216 1.000 Domainoid score I1561
eggNOG 1 0.900 - - E1_COG0100
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 253 1.000 Inparanoid score I1972
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62207
OrthoDB 1 1.010 - - D1408000at2759
OrthoFinder 1 1.000 - - FOG0001674
OrthoInspector 1 1.000 - - otm14679
orthoMCL 1 0.900 - - OOG6_100266
Panther 1 1.100 - - LDO PTHR11759
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1071
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.