DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and KIF3B

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_004789.1 Gene:KIF3B / 9371 HGNCID:6320 Length:747 Species:Homo sapiens


Alignment Length:592 Identity:184/592 - (31%)
Similarity:298/592 - (50%) Gaps:91/592 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DNINVVVRVRPLNDKEKRDRHGSTLQFPGN-GQVILEGNDVGQKRSHNRDSVRVFTYNVVFEPGA 228
            :::.||||.||:|.|||...:...:..... |||     .|...:....:..:.||::.|::..|
Human     8 ESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQV-----SVKNPKGTAHEMPKTFTFDAVYDWNA 67

  Fly   229 TQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLIFRSF 293
            .|.::.|.: .:.:::..::||:.|.|.|||||:|||:|:.|    ..|.|.    :.|:|..||
Human    68 KQFELYDET-FRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEG----IRGDPE----KRGVIPNSF 123

  Fly   294 LYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGGFFVENLFTVDCEE 358
            .::|..|...::..|:::||::|||.|.:.|||:....:: |.:: .:...|.:|::|.:...:.
Human   124 DHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKR-LELK-ERPDTGVYVKDLSSFVTKS 186

  Fly   359 LDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHI-LSDQQTDGGVFLSKH---GKINFVDLA 419
            :.::..|:..|.:||:||:..||:||||||.|..:.| .|:...||    ..|   ||:|.||||
Human   187 VKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEVGLDG----ENHIRVGKLNLVDLA 247

  Fly   420 GSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQLTKLLADSLAGNGV 484
            |||...||.::|:.|:||..||.||..||..||:|.|.|  :.|||||||:||:||.|||.||..
Human   248 GSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGK--STHIPYRDSKLTRLLQDSLGGNAK 310

  Fly   485 TLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALILSLKRDIHALQMENDHLKAA 549
            |:|:|.|.||.||..|||.|||||:|||.|:.||.:..||::||:...:.:|..|:.:.:.....
Human   311 TVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIG 375

  Fly   550 LNLHHQAAPNGGPVENLLELQLDRVSSGGGVPVPKVDLQRLPELDGSELAELVKLYMVENESLRQ 614
            .....:....||             .||||....:.:.:. .|.:|.:          :::..|:
Human   376 RRKRREKRREGG-------------GSGGGGEEEEEEGEE-GEEEGDD----------KDDYWRE 416

  Fly   615 ENNHLFTVRETILRDQEIVCRENERLL----KKLEDVNKVCVRSPLIPARPAISPTTGKETPGTE 675
            :...|...:..|:.|..:|..|..|||    ||:||:.:....:.::.|:  |.....|...|  
Human   417 QQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKDAAEMLGAK--IKAMESKLLVG-- 477

  Fly   676 IWTNPEPLQSPPGPDLPIEQRMSENANRRTDTAQKRIDQKR--IAKNILIMANAFRKPDSDITKE 738
                                  .:|....|:..||.::|||  ||:.        ::.:.:|.::
Human   478 ----------------------GKNIVDHTNEQQKILEQKRQEIAEQ--------KRREREIQQQ 512

  Fly   739 LNLNPEE 745
            :....||
Human   513 MESRDEE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 141/358 (39%)
KISc 166..512 CDD:276812 136/350 (39%)
KIF3BNP_004789.1 KISc_KIF3 8..340 CDD:276822 138/353 (39%)
Smc <352..>614 CDD:224117 41/226 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..412 8/61 (13%)
Globular 580..747
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.