DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and KIF17

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_065867.2 Gene:KIF17 / 57576 HGNCID:19167 Length:1029 Species:Homo sapiens


Alignment Length:633 Identity:199/633 - (31%)
Similarity:302/633 - (47%) Gaps:114/633 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 INVVVRVRPLNDKEKR-----------DRHGSTLQFPGNG-----QVILEGNDVGQKRSHNRDSV 215
            :.||||.||:|.:|:.           .|....:|.||..     |...:|       :::.|.|
Human     6 VKVVVRCRPMNQRERELRCQPVVTVDCARAQCCIQNPGAADEPPKQFTFDG-------AYHVDHV 63

  Fly   216 RVFTYNVVFEPGATQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPN 280
            ....||.:..|               ::|...||::.|.|.||||||||:.|:.|.||       
Human    64 TEQIYNEIAYP---------------LVEGVTEGYNGTIFAYGQTGSGKSFTMQGLPD------- 106

  Fly   281 PKDPRHGLIFRSFLYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSG- 344
            |...| |:|.|:|.::|:.::..::..::::||::|||||.|.|||...:.:| |.::...:.| 
Human   107 PPSQR-GIIPRAFEHVFESVQCAENTKFLVRASYLEIYNEDVRDLLGADTKQK-LELKEHPEKGV 169

  Fly   345 ---GFFVENLFTV-DCEELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGV 405
               |..:..:.:| .||.      ::|.|.:||:||...||..|||||:|.|:.|......:.|.
Human   170 YVKGLSMHTVHSVAQCEH------IMETGWKNRSVGYTLMNKDSSRSHSIFTISIEMSAVDERGK 228

  Fly   406 FLSKHGKINFVDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQ 470
            ...:.||:|.|||||||...||.:.|:.|:||..||.||..||..||:|.|.  |..|:|||||:
Human   229 DHLRAGKLNLVDLAGSERQSKTGATGERLKEATKINLSLSALGNVISALVDG--RCKHVPYRDSK 291

  Fly   471 LTKLLADSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALILSLKRD 535
            ||:||.|||.||..|||:||:|||..|:.|||:|||||:|||.||.||.|..||::||:...:.:
Human   292 LTRLLQDSLGGNTKTLMVACLSPADNNYDETLSTLRYANRAKNIRNKPRINEDPKDALLREYQEE 356

  Fly   536 IHAL------QMENDHLKAALNLHHQAAPNGGPVENLLELQLDRVSSGGGVPVPKVDLQRLPELD 594
            |..|      ||....|.|.|:  .|..|:...||..|..|          ||.:.|::...:|.
Human   357 IKKLKAILTQQMSPSSLSALLS--RQVPPDPVQVEEKLLPQ----------PVIQHDVEAEKQLI 409

  Fly   595 GSE----LAELVKLYMVENES-LRQENN----------HLFTVRETILRDQEIVCRENERLLKKL 644
            ..|    ||.|...|..|.|| .|.|.:          .|.|:.|.:.::.|.|.:..  :|.|.
Human   410 REEYEERLARLKADYKAEQESRARLEEDITAMRNSYDVRLSTLEENLRKETEAVLQVG--VLYKA 472

  Fly   645 EDVNKVCVRS-----PLIPARPAISPTTGKETPGTEIWTNPEPLQSPPGPDLPIEQRMSENANRR 704
            |.:::....|     |.......:.|         ::::..:.|.|.......:..|.:|..  :
Human   473 EVMSRAEFASSAEYPPAFQYETVVKP---------KVFSTTDTLPSDDVSKTQVSSRFAELP--K 526

  Fly   705 TDTAQKRIDQKRIAKNIL---IMANAFRKPDSDITKELNLNPEEAHAK 749
            .:.::..|.......:.|   .::.||..|:.....|:::..||:.::
Human   527 VEPSKSEISLGSSESSSLEETSVSEAFPGPEEPSNVEVSMPTEESRSR 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 144/373 (39%)
KISc 166..512 CDD:276812 138/365 (38%)
KIF17NP_065867.2 Motor_domain 4..335 CDD:277568 140/367 (38%)
Kinesin 11..335 CDD:278646 137/362 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 523..569 7/47 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 647..673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 908..931
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 968..1029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.