DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and sub

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_001286548.1 Gene:sub / 44870 FlyBaseID:FBgn0003545 Length:628 Species:Drosophila melanogaster


Alignment Length:632 Identity:170/632 - (26%)
Similarity:239/632 - (37%) Gaps:208/632 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SSRNTPYFLRSRENEIGSADTLEIVASKSTGSEECSTPEDNINVVVRVRPLNDKEKRDRHGSTLQ 190
            |...:.|..:|.|...|        ||.:|.:.:.|..|....|.:|:||:.|..|         
  Fly    55 SDTESEYKYQSSEATEG--------ASCATSAADSSNVETGPQVFLRLRPVKDASK--------- 102

  Fly   191 FPGNGQVILE--------------GNDVGQKRSHNRDSVRVFTYNVVFEPGATQEDILDYSGIKR 241
                ..::.|              .|:|.:...|       |.:..:|:....|.||.|.....:
  Fly   103 ----AYIVSEEANVLITSCKVDSTSNNVNRMEKH-------FGFTSIFDSTVGQRDIYDTCVGPK 156

  Fly   242 IIEMGIEGFSC-TAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLI---------------F 290
            |:|.     .| |...||.:|||||:||.|           .|.|.|:|               |
  Fly   157 IMEE-----ECVTIMTYGTSGSGKTYTLLG-----------DDVRAGIIPRALENIFTIYQDTVF 205

  Fly   291 RS-----------FL------------------------------------YLFQLIKNRKDVNY 308
            ||           ||                                    ::|: .|...||:.
  Fly   206 RSPKLKLINGSIVFLQDDASLKELQIRKKLLDLCPDISAHHQRLKQVIDGDHMFE-TKASTDVSV 269

  Fly   309 VLKASFMEIYNERVIDLL-------NPGSA-RKPLAVRWSKKSGGFFVENLFTVDCEELDDLLAV 365
            ::..||:|||||.|.|||       ..|.. ||.|.:..:|  |..|::.|.:|.....::.|.:
  Fly   270 LVWVSFVEIYNELVYDLLAIPPKQDKLGEVPRKNLKIVGNK--GHVFIKGLTSVFVTSSEEALRL 332

  Fly   366 LEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFLSKHGKINFVDLAGSELTKKTMSE 430
            |..|.:.....|.::|.:|||||.:.||.||...::.    ::......|.||||||....|.:.
  Fly   333 LRLGQQRSTYASTSVNANSSRSHCVFTVDILKYNRSG----ITTQSSYKFCDLAGSERVNNTGTS 393

  Fly   431 GKTLEEANNINKSLMVLGYCISSLS--DSKKRTGHIPYRDSQLTKLLADSLAGNGVTLMIACVSP 493
            |..|:||.|||.||||||.|:.:.|  ..||....||||||:||.||..:|.|.....||..|:|
  Fly   394 GLRLKEAKNINTSLMVLGRCLDAASTVQKKKNADIIPYRDSKLTMLLQAALLGKEKLAMIVTVTP 458

  Fly   494 AHYNHAETLNTLRYASRAKRIRTK-PVIKMDPREALILSLKRDIHALQ----MENDHLKAALNLH 553
            ....:.|.||.|.:||.||.|..| ||||.              |.:.    ||...:...    
  Fly   459 LDKYYEENLNVLNFASIAKNIIFKEPVIKQ--------------HRVSYCGFMEFSKMSTC---- 505

  Fly   554 HQAAPNGGPVENLLE-----LQLDRVSSGGGVPVPKVDLQRLPELDGSELAELVKLYMVENESLR 613
                 .||.....||     |||                    |::..:...::::.::| |.||
  Fly   506 -----EGGDYTKELEDENVRLQL--------------------EIEQLKYDHVLQMQLLE-EKLR 544

  Fly   614 QENNHLFTVRETILRDQEIVCRENERLLKKLEDVNKVCVRSPLIPAR 660
                     ||.....|||:  :|.:  |:.||   .|.:..||..|
  Fly   545 ---------RELTATYQEII--QNNK--KQYED---ECEKKLLIAQR 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 129/441 (29%)
KISc 166..512 CDD:276812 124/432 (29%)
subNP_001286548.1 KISc 89..477 CDD:276812 124/430 (29%)
Kinesin 93..479 CDD:278646 125/428 (29%)
GBP_C <512..603 CDD:303769 23/101 (23%)
coiled coil 576..586 CDD:293879 170/632 (27%)
coiled coil 592..603 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.