DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and Klp64D

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_523934.1 Gene:Klp64D / 38611 FlyBaseID:FBgn0004380 Length:677 Species:Drosophila melanogaster


Alignment Length:592 Identity:189/592 - (31%)
Similarity:299/592 - (50%) Gaps:87/592 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 DNINVVVRVRPLNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDSVRVFTYNVVFEPGAT 229
            :|:.||||.||::..|......|.:......:.|    .|.:..:...:..:.:.::.||:.|:.
  Fly    19 ENVRVVVRTRPMDKNELSAGALSAISVDKINRAI----TVMKPNATANEPPKTYYFDNVFDGGSN 79

  Fly   230 QEDILDYSGIKR-IIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLIFRSF 293
            |.|:  |....| |::..:||::.|...|||||:|||:|::|.||    .|..|    |:|..:|
  Fly    80 QMDL--YVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPD----SPQTK----GIIPNAF 134

  Fly   294 LYLF-QLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGGFFVENLFTVDCE 357
            .::| .:.|.:::..::::.|:||||||.|.|||.. ...|.|.|: .:...|.||::|......
  Fly   135 AHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGK-DVGKSLEVK-ERPDIGVFVKDLSGYVVH 197

  Fly   358 ELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFLSKHGKINFVDLAGSE 422
            ..|||..::..|.:|||||:..||..|||||.|.::.:...:..:|.|...:.||:..|||||||
  Fly   198 NADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQHVRMGKLQLVDLAGSE 262

  Fly   423 LTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQLTKLLADSLAGNGVTLM 487
            ...||.:.|:.|:||..||.||.|||..||:|.|.|  :.|||||:|:||:||.|||.||..|:|
  Fly   263 RQSKTQASGQRLKEATKINLSLSVLGNVISALVDGK--STHIPYRNSKLTRLLQDSLGGNSKTVM 325

  Fly   488 IACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALILSLKRDIHALQM---ENDHLKAA 549
            .|.:|||..|:.||::|||||||||.|:.:..|..:|::||:...:.:|..|:.   |.|.|:  
  Fly   326 CATISPADSNYMETISTLRYASRAKNIQNRMHINEEPKDALLRHFQEEIARLRKQLEEGDSLE-- 388

  Fly   550 LNLHHQAAPNGGPVENL--------LELQLDRVSSGGGVPVPKVDLQRLPELDGSELAELVKLYM 606
                 :..|:....|:.        ||::|:..:.......||    :..|...:|..||.|.  
  Fly   389 -----EEPPSSEEEEDTADDELEAPLEIELESSTIQAVEKKPK----KKREKTDAEKEELAKR-- 442

  Fly   607 VENESLRQENNHLFTVRETILRDQEIVCRENERLLKKLEDVNKVCVRSPLIPARPAISPTTGKET 671
             :||. ::|..|..|.:|| ||::          |..||                      ||..
  Fly   443 -KNEH-QKEIEHAKTEQET-LRNK----------LVSLE----------------------GKIL 472

  Fly   672 PGTEIWTNPEPLQSPPGPDLPIEQRMSE-NANRRTDTAQKRIDQKRIAKNILI--MANAFRKPDS 733
            .|.|     ..|:.....:|.:||.::| ..:.:::.|.|:..|::..:.|.|  ..:..:...:
  Fly   473 VGGE-----NLLEKAQTQELLLEQSIAELEQHEKSEEALKQTLQQKATERIDIEERYSTLQDAST 532

  Fly   734 DITKELN 740
            .|||:::
  Fly   533 GITKKIH 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 139/355 (39%)
KISc 166..512 CDD:276812 136/347 (39%)
Klp64DNP_523934.1 KISc_KIF3 19..352 CDD:276822 138/350 (39%)
Kinesin 26..352 CDD:278646 134/343 (39%)
RILP-like <437..556 CDD:304877 32/145 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24115
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.