DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and Klp61F

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_476818.1 Gene:Klp61F / 38135 FlyBaseID:FBgn0004378 Length:1066 Species:Drosophila melanogaster


Alignment Length:658 Identity:191/658 - (29%)
Similarity:300/658 - (45%) Gaps:114/658 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VASKSTGSEECSTPEDNINVVVRVRPLNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDS 214
            ::..:|..:.......||.|.|||||||.:|:..|....:...|..:|:..         |..||
  Fly     3 ISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTR---------HTLDS 58

  Fly   215 --VRVFTYNVVFEPGATQEDILDYS-GIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFV 276
              .:.||::..|.|.:.|.|:  || .:..:||..:.|::||.|.|||||:|||||:.|.....:
  Fly    59 KLTKKFTFDRSFGPESKQCDV--YSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAEL 121

  Fly   277 GKPNPKDPRHGLIFRSFLYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSK 341
            ......|...|:|.|:..:||..:: ..:|.|.::.|::|:|||.:.|||:.....|......|.
  Fly   122 KSSWEDDSDIGIIPRALSHLFDELR-MMEVEYTMRISYLELYNEELCDLLSTDDTTKIRIFDDST 185

  Fly   342 KSGGFFVENLFTVDCEELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTI--LTVHILSDQQTDG- 403
            |.|...::.|..:.....||:..:||:|...|...:..||..||||||:  :.|||    :.:| 
  Fly   186 KKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHI----RENGI 246

  Fly   404 -GVFLSKHGKINFVDLAGSELTKKTMSE-GKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPY 466
             |..:.|.||:|.|||||||...|..:| |..:.|..|||:||:.||..|::|.|   |..|:||
  Fly   247 EGEDMLKIGKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVD---RAPHVPY 308

  Fly   467 RDSQLTKLLADSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPREALIL- 530
            |:|:||:||.:||.|...|.:||.:||.|.:..|||:||.||.|||.|:.||.:.....:..:| 
  Fly   309 RESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTKKTVLK 373

  Fly   531 -------SLKRDIHALQ-------MENDHLKAALNLHHQAAPNGGPVENLLELQLDRVSSGGGVP 581
                   .||||:.|.:       .|..:.:..|.|..|   |....|.:|.|:           
  Fly   374 EYTEEIDKLKRDLMAARDKNGIYLAEETYGEITLKLESQ---NRELNEKMLLLK----------- 424

  Fly   582 VPKVDLQRLPELDGSELAELVKLYMVENESLRQENNHLFTVRETILRDQEIVCRENERLLKKLED 646
            ..|.:||...::.......||:    :.:.|::...:|...:.|:|..::::.:...|..:|.|.
  Fly   425 ALKDELQNKEKIFSEVSMSLVE----KTQELKKTEENLLNTKGTLLLTKKVLTKTKRRYKEKKEL 485

  Fly   647 V-------NKVCVRSPLIPARPAISPTTGKETPGTEIWTNPEPLQSPPGPDLPIEQR--MSENAN 702
            |       ..:..::..|.|...::.....:..||                  ||:|  :.|...
  Fly   486 VASHMKTEQVLTTQAQEILAAADLATDDTHQLHGT------------------IERRRELDEKIR 532

  Fly   703 RRTDTAQKRI---------------DQKRIAKNILI--MANAFRKPDSDITKELNLNPEEAHAKQ 750
            |..|..:.|:               ||:...|..|.  |.|:     |.:::.|.||     :.:
  Fly   533 RSCDQFKDRMQDNLEMIGGSLNLYQDQQAALKEQLSQEMVNS-----SYVSQRLALN-----SSK 587

  Fly   751 STEFMPDM 758
            |.|.:.:|
  Fly   588 SIEMLKEM 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 139/361 (39%)
KISc 166..512 CDD:276812 134/353 (38%)
Klp61FNP_476818.1 KISc_BimC_Eg5 17..365 CDD:276815 139/366 (38%)
Kinesin 25..356 CDD:278646 132/349 (38%)
Microtub_bind 923..>1009 CDD:290642
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437877
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.