DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and CG32318

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:130 Identity:40/130 - (30%)
Similarity:62/130 - (47%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 VASKSTGSEECSTPEDNINVVVRVRPLNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDS 214
            ::..:|..:.......||.|.|||||||.:|:..|....:...|..:|:..         |..||
  Fly     3 ISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREVVTR---------HTLDS 58

  Fly   215 --VRVFTYNVVFEPGATQEDILDYS-GIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFV 276
              .:.||::..|.|.:.|.|:  || .:..:||..:.|::||.|.|||||    :.|..|..|::
  Fly    59 KLTKKFTFDRSFGPESKQCDV--YSVVVSPLIEEVLNGYNCTVFAYGQTG----NNLRPPKSLYI 117

  Fly   277  276
              Fly   118  117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 39/114 (34%)
KISc 166..512 CDD:276812 39/114 (34%)
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 34/99 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437878
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.