DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and KIF6

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:XP_005248961.1 Gene:KIF6 / 221458 HGNCID:21202 Length:842 Species:Homo sapiens


Alignment Length:531 Identity:151/531 - (28%)
Similarity:236/531 - (44%) Gaps:109/531 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 EDNINVVVRVRP-----------LNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDSVRV 217
            :..|.:..||:|           :::.||        ..| :.::||. .|:.....:|:.....
Human     3 KQTIQIFARVKPPVRKHQQGIYSIDEDEK--------LIP-SLEIILP-RDLADGFVNNKRESYK 57

  Fly   218 FTYNVVFEPGATQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPK 282
            |.:..:|:..|.||.:.: :..|.:....:.|::.|.|.|||||||||.|:||..:.:..:    
Human    58 FKFQRIFDQDANQETVFE-NIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDR---- 117

  Fly   283 DPRHGLIFRSFLYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARK-----PLAVRWSKK 342
                |:|.|:..|:|:.::......|....|::|||||...|||:|.....     |........
Human   118 ----GIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYNECGYDLLDPRHEASSLEDLPKVTILEDP 178

  Fly   343 SGGFFVENLFTVDCEELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFL 407
            .....::||........::.|.:|..|..||.:....||..|:|||.|.|:|:.|.:.....|  
Human   179 DQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHCIFTIHLSSKEPGSATV-- 241

  Fly   408 SKHGKINFVDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSDSKKRTGHIPYRDSQLT 472
             :|.|::.|||||||...||...|..|.||..||.||..|...|.:||:  |...|||||:|.:|
Human   242 -RHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSE--KHRSHIPYRNSMMT 303

  Fly   473 KLLADSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVI--KMDPREALILSLKRD 535
            .:|.|||.||.:|.|||.:|....|..|:::|.|:|.|...|:.:.|:  :::||    |.:|| 
Human   304 SVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPR----LVIKR- 363

  Fly   536 IHALQMENDHLKAALNLHHQAAPNGGPVENLLELQLDRVSSGGGVPVPKVDLQRLPELDGSELAE 600
               ||.|...||                        |.::...|.       ||...|..:||.:
Human   364 ---LQKEIQELK------------------------DELAMVTGE-------QRTEALTEAELLQ 394

  Fly   601 LVKL---YMVENES---------LRQENNHLFTVRETILRDQEIV-------------CRE--NE 638
            |.||   ::.:.:|         :|:. :|.|...:.:|.|::|:             |:|  .|
Human   395 LEKLITSFLEDQDSDSRLEVGADMRKV-HHCFHHLKKLLNDKKILENNTVSSESKDQDCQEPLKE 458

  Fly   639 RLLKKLEDVNK 649
            ...:||.|:.|
Human   459 EEYRKLRDILK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 116/369 (31%)
KISc 166..512 CDD:276812 115/361 (32%)
KIF6XP_005248961.1 Motor_domain 5..343 CDD:277568 115/361 (32%)
Kinesin 11..345 CDD:278646 114/357 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.