DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp54D and Kif15

DIOPT Version :9

Sequence 1:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster
Sequence 2:NP_034750.1 Gene:Kif15 / 209737 MGIID:1098258 Length:1387 Species:Mus musculus


Alignment Length:665 Identity:207/665 - (31%)
Similarity:291/665 - (43%) Gaps:127/665 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 SEECSTPEDNINVVVRVRPLNDKEKRDRHGSTLQFPGNGQVILEGNDVGQKRSHNRDSVRVFTYN 221
            |.:.|...|.|.|.||:||..:..:        ...|.....|........|.|:....:.|.::
Mouse    17 SNQPSNEGDAIKVFVRIRPAEEGAR--------SADGEQSFCLSVLSQTTLRLHSNPDPKTFVFD 73

  Fly   222 VVFEPGATQEDILDYSGI-KRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPR 285
            .|.....|||.:  :|.: |.|:|..:.|::.|.|.|||||||||.|:.||.|    ..|.....
Mouse    74 YVAGMDTTQESV--FSTVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMGPSD----SDNFSHNL 132

  Fly   286 HGLIFRSFLYLFQLIKNRKD-----VNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGG 345
            .|:|.|||.|||.||...|:     .:::.|.||:|:|||::.|||:  ||...|.:|...|.|.
Mouse   133 RGIIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEVYNEQIYDLLD--SASVGLYLREHIKKGV 195

  Fly   346 FF---VENLFTVDCEELDDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFL 407
            |.   ||...|...|...    ||..|.|||.|.|.:||..|||||.:.|:.|.|.:::...|.:
Mouse   196 FVVGAVEQAVTSAAETYQ----VLSRGWRNRRVASTSMNRESSRSHAVFTITIESMEKSSETVNI 256

  Fly   408 SKHGKINFVDLAGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLSD---SKKRTGHIPYRDS 469
             :...:|.|||||||..|.|.:||..|:||.|||:||..||..|::|.|   .|:|  ||.||||
Mouse   257 -RTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVITALVDVGNGKQR--HICYRDS 318

  Fly   470 QLTKLLADSLAGNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKPVIKMDPR------EAL 528
            :||.||.|||.||..|.:||.|.|......|||:||.:|.|||.|:.|.|:..|.:      :|.
Mouse   319 KLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFAQRAKLIKNKAVVNEDTQGNVSQLQAE 383

  Fly   529 ILSLK------------------RDIHALQMENDHLKAALNLHHQAAPNGGPVENLLELQ----- 570
            :..||                  ||..........|:|.|............:|.:.:|:     
Mouse   384 VKRLKEQLSQFTSGQITPESLLARDKEKTNYIEYFLEAMLFFKKSEQEKKSLIEKITQLEDLTLK 448

  Fly   571 ---------------------LDRV-SSGGGVPVPKVDLQRLPEL--DGSELAELVK------LY 605
                                 |:|: ..|.|..:|:...:.|.||  :...|.|.|:      .|
Mouse   449 KEKFIQSNKMIVKFREDQIMRLERLHKEGRGSFLPEEQDRLLSELRDEVQTLREHVEHHPRLAKY 513

  Fly   606 MVENESLRQENNHLFTVRETILRDQEIVCRENERLLKKLEDVNKVCVRSPLIPARPAISPTTGKE 670
            .:||.|||:||..| .:...:.|..||..:...||.|...:|:......   ......||...||
Mouse   514 AMENHSLREENRRL-KLLAPVKRAHEIDAQSIARLEKAFAEVSSTETND---KGLQGFSPKALKE 574

  Fly   671 TPGTEIWTNPEPLQSPPGPDLPIEQRMSENANRRTDTAQKRIDQKRIAKNILIMANAFRKPDSDI 735
               :..:||.|.|::..   |.|:..::       ::.|:..:.|.:.          ||...::
Mouse   575 ---SSFFTNTEKLKAQL---LQIQTELN-------NSKQEYEEFKELT----------RKKQLEL 616

  Fly   736 TKEL------NLNPE 744
            ..||      |||.|
Mouse   617 ESELQSLQKANLNLE 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 145/365 (40%)
KISc 166..512 CDD:276812 141/357 (39%)
Kif15NP_034750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 2/5 (40%)
KISc_KLP2_like 25..373 CDD:276824 147/370 (40%)
KISc 26..370 CDD:214526 146/366 (40%)
Kinesin-relat_1 463..551 CDD:289481 26/88 (30%)
SMC_prok_B 520..1339 CDD:274008 32/139 (23%)
HMMR_C 1267..>1387 CDD:292530
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.