DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment term and FUS1

DIOPT Version :9

Sequence 1:NP_524882.2 Gene:term / 47208 FlyBaseID:FBgn0003683 Length:428 Species:Drosophila melanogaster
Sequence 2:NP_009903.2 Gene:FUS1 / 850330 SGDID:S000000532 Length:512 Species:Saccharomyces cerevisiae


Alignment Length:364 Identity:67/364 - (18%)
Similarity:129/364 - (35%) Gaps:85/364 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PIISSFVFTNEETTQTFHHQWFSQGQLHECATC-----YSSIDADEPPSQHWLRGGEASQGLHLT 64
            |.:|:.:...||..:  ...|||  :|...:.|     ||:.|.::.....|..|...|..:...
Yeast   106 PPMSATIPREEEYCR--RTNWFS--RLFWQSKCEDQNSYSNRDIEKYNDTQWTSGDNMSSKIQYK 166

  Fly    65 KQQQAV-MDIIEARQIETFFFCDESSKDKLEHFMGETCARGIPELLRWMFQNNTVAVEFNLACYV 128
            ..:..: ..|:..::.....:........|:..:.|.....:.:...:....|.|.:|.::..|.
Yeast   167 ISKPIIPQHILTPKKTVKNPYAWSGKNISLDPKVNEMEEEKVVDAFLYTKPPNIVHIESSMPSYN 231

  Fly   129 NAMDQVLI-FQSGSLRADHHYDVDESVGVVYEMLMQRIENYLNCSS---EYGMAECSI------T 183
            :...|..: .:..:|:....:.        ||..:.|.  :|..|:   :||:::.|:      .
Yeast   232 DLPSQKTVSSKKTALKTSEKWS--------YESPLSRW--FLRGSTYFKDYGLSKTSLKTPTGAP 286

  Fly   184 RLKVQVKRIRVEADGQSADSSVFA-----------LPLQLQEEEGLTATTGCSTSEAELASLRSA 237
            :|| |:|.:...:.|...:|.:..           .||...:.   ....|.:|.::::.|.|  
Yeast   287 QLK-QMKMLSRISKGYFNESDIMPDERSPILEYNNTPLDANDS---VNNLGNTTPDSQITSYR-- 345

  Fly   238 YLKHFRECNGYFPPNMRVNLYGLQQCKTTKELYVVPYHISETLQQLPNKNFLILNNIMGQFQRLH 302
                          |..::|       .|...:.|.|  ..|.||....||...::.....:: |
Yeast   346 --------------NNNIDL-------ITARPHSVIY--GTTAQQTLETNFNDHHDCNKSTEK-H 386

  Fly   303 ELSTPVNSIERDQTSSPLKDLHCRRCRTQFSRRSKLHIH 341
            ||..|          :|.|.|..|:.|    |:||::.|
Yeast   387 ELIIP----------TPSKPLKKRKKR----RQSKMYQH 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
termNP_524882.2 None
FUS1NP_009903.2 SH3_Fus1p 440..509 CDD:212788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.788662 Normalized mean entropy S7188
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.