DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgs7 and Sgs3

DIOPT Version :10

Sequence 1:NP_476718.1 Gene:Sgs7 / 47198 FlyBaseID:FBgn0003377 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_524024.1 Gene:Sgs3 / 39288 FlyBaseID:FBgn0003373 Length:307 Species:Drosophila melanogaster


Alignment Length:49 Identity:28/49 - (57%)
Similarity:38/49 - (77%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CECQPCGPGGKACTGCPEKPQLCQQLISDIRNLQQKIRKCVCGEPQWMI 74
            |.|:.|||||:.|.||.::..|||.|...:|||::|||:||||||||::
  Fly   259 CGCKSCGPGGEPCNGCAKRDALCQDLNGVLRNLERKIRQCVCGEPQWLL 307

Return to query results.
Submit another query.