DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sgs7 and Sgs8

DIOPT Version :9

Sequence 1:NP_476718.1 Gene:Sgs7 / 47198 FlyBaseID:FBgn0003377 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_476719.2 Gene:Sgs8 / 39285 FlyBaseID:FBgn0003378 Length:75 Species:Drosophila melanogaster


Alignment Length:74 Identity:35/74 - (47%)
Similarity:51/74 - (68%) Gaps:1/74 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLIAVTIIACILLIGFSDLALG-GACECQPCGPGGKACTGCPEKPQLCQQLISDIRNLQQKIRK 64
            |||:.|.:||||:||||:|.|.| ..|.|..|||||:.|.||..:..:|:.||:.:..|::::|:
  Fly     1 MKLLVVAVIACIMLIGFADPASGCKDCSCVICGPGGEPCPGCSARVPVCKDLINIMEGLERQVRQ 65

  Fly    65 CVCGEPQWM 73
            |.|||..|:
  Fly    66 CACGEQVWL 74



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016787
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.