DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Men and SPAC750.08c

DIOPT Version :9

Sequence 1:NP_524880.2 Gene:Men / 47173 FlyBaseID:FBgn0002719 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_595034.1 Gene:SPAC750.08c / 2542710 PomBaseID:SPAC750.08c Length:228 Species:Schizosaccharomyces pombe


Alignment Length:174 Identity:53/174 - (30%)
Similarity:88/174 - (50%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 LAEAVRKVRPNVLIGAAAQGGAFNQEILELMADINETPIIFALSNPTSKAECTAEEAYTYTKGRC 633
            |..|:..::|.||:|.:.|.|.|.::.:..|:...:.||||.:||||:..|....:...::.|:.
pombe    38 LETAISLIKPTVLLGCSGQPGKFTEKAIREMSKHVKHPIIFPISNPTTLMEAKPVQIDEWSNGKA 102

  Fly   634 IFASGSPFAPVTYNNKKFYPGQGNNSYIFPGVALGVLCA---------GMLNIPEQVFLVAAERL 689
            :.|:|||..|:|.|.|::...|.||:.::|  ||||.|.         |||.       .|::.|
pombe   103 LMATGSPLPPLTRNGKEYVISQCNNALLYP--ALGVACVLSRCKLLSDGMLK-------AASDAL 158

  Fly   690 AELVSKDDLAKGSLYPPLSSIVSCSMAIAERIVEYAYKNGLATV 733
            |.:.....:|..:|.|.|.:....|..|...:::.|...|::||
pombe   159 ATVPRSLFVADEALLPDLDNAREISRHIVFAVLKQAISEGMSTV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MenNP_524880.2 PLN03129 213..757 CDD:215594 53/174 (30%)
malic 282..463 CDD:278802
NAD_bind_1_malic_enz 473..750 CDD:133454 53/174 (30%)
SPAC750.08cNP_595034.1 NADB_Rossmann <1..222 CDD:304358 53/174 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1122
eggNOG 1 0.900 - - E1_COG0281
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000475
OrthoInspector 1 1.000 - - mtm9297
orthoMCL 1 0.900 - - OOG6_100205
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.