DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knk and THBD

DIOPT Version :10

Sequence 1:NP_649981.1 Gene:knk / 47137 FlyBaseID:FBgn0001321 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_000352.1 Gene:THBD / 7056 HGNCID:11784 Length:575 Species:Homo sapiens


Alignment Length:30 Identity:12/30 - (40%)
Similarity:16/30 - (53%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   431 NNEPAFHTY-YPKSDIVIDFNTTEPVNDCF 459
            |.:..|..: ||..|:| |....|||:.||
Human   342 NTQGGFECHCYPNYDLV-DGECVEPVDPCF 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knkNP_649981.1 DM13 51..156 CDD:128929
DM13 166..272 CDD:128929
DoH 292..454 CDD:214768 7/23 (30%)
THBDNP_000352.1 CLECT_thrombomodulin_like 30..171 CDD:153070
FXa_inhibition 245..280 CDD:464251
FXa_inhibition 289..323 CDD:464251
EGF_CA 325..>355 CDD:214542 4/12 (33%)
Tme5_EGF_like 406..439 CDD:312559
EGF_CA 441..>468 CDD:214542
Involved in alpha-L/beta-2 and alpha-M/beta-2 integrin binding. /evidence=ECO:0000269|PubMed:27055590 481..515
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 484..506
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.