| Sequence 1: | NP_649981.1 | Gene: | knk / 47137 | FlyBaseID: | FBgn0001321 | Length: | 689 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_000352.1 | Gene: | THBD / 7056 | HGNCID: | 11784 | Length: | 575 | Species: | Homo sapiens |
| Alignment Length: | 30 | Identity: | 12/30 - (40%) |
|---|---|---|---|
| Similarity: | 16/30 - (53%) | Gaps: | 2/30 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 431 NNEPAFHTY-YPKSDIVIDFNTTEPVNDCF 459 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| knk | NP_649981.1 | DM13 | 51..156 | CDD:128929 | |
| DM13 | 166..272 | CDD:128929 | |||
| DoH | 292..454 | CDD:214768 | 7/23 (30%) | ||
| THBD | NP_000352.1 | CLECT_thrombomodulin_like | 30..171 | CDD:153070 | |
| FXa_inhibition | 245..280 | CDD:464251 | |||
| FXa_inhibition | 289..323 | CDD:464251 | |||
| EGF_CA | 325..>355 | CDD:214542 | 4/12 (33%) | ||
| Tme5_EGF_like | 406..439 | CDD:312559 | |||
| EGF_CA | 441..>468 | CDD:214542 | |||
| Involved in alpha-L/beta-2 and alpha-M/beta-2 integrin binding. /evidence=ECO:0000269|PubMed:27055590 | 481..515 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 484..506 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||