DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knk and CG34355

DIOPT Version :10

Sequence 1:NP_649981.1 Gene:knk / 47137 FlyBaseID:FBgn0001321 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_001247269.1 Gene:CG34355 / 42820 FlyBaseID:FBgn0085384 Length:755 Species:Drosophila melanogaster


Alignment Length:40 Identity:12/40 - (30%)
Similarity:17/40 - (42%) Gaps:10/40 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 QTCKMVSMLSICVNPFLYGFLNTNFRHEFSDIYYRYIRCE 410
            :|.::|..||...||.| .|:.|         |..|:..|
  Fly   154 KTAELVGSLSGSTNPVL-SFITT---------YAPYVNLE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knkNP_649981.1 DM13 51..156 CDD:128929
DM13 166..272 CDD:128929
DoH 292..454 CDD:214768 12/40 (30%)
CG34355NP_001247269.1 DM13 89..194 CDD:463130 12/40 (30%)
DM13 211..317 CDD:128929
DoH 350..515 CDD:214768
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.