| Sequence 1: | NP_649981.1 | Gene: | knk / 47137 | FlyBaseID: | FBgn0001321 | Length: | 689 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001247269.1 | Gene: | CG34355 / 42820 | FlyBaseID: | FBgn0085384 | Length: | 755 | Species: | Drosophila melanogaster |
| Alignment Length: | 40 | Identity: | 12/40 - (30%) |
|---|---|---|---|
| Similarity: | 17/40 - (42%) | Gaps: | 10/40 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 371 QTCKMVSMLSICVNPFLYGFLNTNFRHEFSDIYYRYIRCE 410 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| knk | NP_649981.1 | DM13 | 51..156 | CDD:128929 | |
| DM13 | 166..272 | CDD:128929 | |||
| DoH | 292..454 | CDD:214768 | 12/40 (30%) | ||
| CG34355 | NP_001247269.1 | DM13 | 89..194 | CDD:463130 | 12/40 (30%) |
| DM13 | 211..317 | CDD:128929 | |||
| DoH | 350..515 | CDD:214768 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||