DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment knk and Thbd

DIOPT Version :9

Sequence 1:NP_649981.1 Gene:knk / 47137 FlyBaseID:FBgn0001321 Length:689 Species:Drosophila melanogaster
Sequence 2:NP_033404.1 Gene:Thbd / 21824 MGIID:98736 Length:577 Species:Mus musculus


Alignment Length:181 Identity:35/181 - (19%)
Similarity:53/181 - (29%) Gaps:70/181 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 NDCFAFTKRAETTNPPVWERTRITDATVRTFNAYLGPSGGLRGYQGLTNHVSSGLAWYINGYMIP 520
            ::|||..:...|                     :|..|...:..||....|.|.:|..:...::.
Mouse    33 HECFALFQGPAT---------------------FLDASQACQRLQGHLMTVRSSVAADVISLLLS 76

  Fly   521 ELYLKRGLTYTFKVRGGNNPHSPEHYHPL----VITDDPQGGYDRLSDAKQSEIRVLAGVEFTRR 581
            :..:..|.....::..|.:  .|.|..||    .:|.|....|.|.:                  
Mouse    77 QSSMDLGPWIGLQLPQGCD--DPVHLGPLRGFQWVTGDNHTSYSRWA------------------ 121

  Fly   582 GRPKPTAA---GPLCLSRYPQNSDRRLDDNFPTFKKFNRSLITECVEGEPA 629
             ||....|   ||||::                     .|..||...||||
Mouse   122 -RPNDQTAPLCGPLCVT---------------------VSTATEAAPGEPA 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
knkNP_649981.1 DM13 51..156 CDD:128929
DM13 166..272 CDD:128929
DoH 292..454 CDD:214768
ThbdNP_033404.1 CLECT 30..169 CDD:295302 35/181 (19%)
FXa_inhibition 244..279 CDD:291342
FXa_inhibition 291..322 CDD:291342
EGF_CA 324..360 CDD:284955
Plasmod_Pvs28 346..467 CDD:283826
Tme5_EGF_like 405..438 CDD:286192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24036
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.