DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NDUFB7 and ND-B18

DIOPT Version :9

Sequence 1:NP_004137.2 Gene:NDUFB7 / 4713 HGNCID:7702 Length:137 Species:Homo sapiens
Sequence 2:NP_001285259.1 Gene:ND-B18 / 32434 FlyBaseID:FBgn0030605 Length:117 Species:Drosophila melanogaster


Alignment Length:105 Identity:57/105 - (54%)
Similarity:72/105 - (68%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    15 VEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLA 79
            |.|.|..:|||.|..||..||||.|:|||:||..|:|.|:.||||||..|....|:.|:||....
  Fly    13 VMPGPDVVPTFDPLLGFKSRKERVMIATQEEMESAKLPLEFRDYCAHLAIAYQACRSDTFPFVYK 77

Human    80 CKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKA 119
            |..::|::..||:.|||:||||||||||||:|:||..|.|
  Fly    78 CAHQKHEYLTCEYEDYVLRMKEFERERRLLERQKRLNKAA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NDUFB7NP_004137.2 NDUF_B7 41..100 CDD:398999 27/58 (47%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 59..69 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 80..90 2/9 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..137 4/7 (57%)
ND-B18NP_001285259.1 NDUF_B7 38..100 CDD:283359 29/61 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150747
Domainoid 1 1.000 73 1.000 Domainoid score I9280
eggNOG 1 0.900 - - E1_KOG3468
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3059
Inparanoid 1 1.050 119 1.000 Inparanoid score I4789
Isobase 1 0.950 - 0 Normalized mean entropy S3726
OMA 1 1.010 - - QHG45746
OrthoDB 1 1.010 - - D1570033at2759
OrthoFinder 1 1.000 - - FOG0006528
OrthoInspector 1 1.000 - - oto91685
orthoMCL 1 0.900 - - OOG6_103294
Panther 1 1.100 - - LDO PTHR20900
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2667
SonicParanoid 1 1.000 - - X4760
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1817.750

Return to query results.
Submit another query.