DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NDUFB6 and ND-B17

DIOPT Version :9

Sequence 1:NP_002484.1 Gene:NDUFB6 / 4712 HGNCID:7701 Length:128 Species:Homo sapiens
Sequence 2:NP_609765.1 Gene:ND-B17 / 34925 FlyBaseID:FBgn0001989 Length:167 Species:Drosophila melanogaster


Alignment Length:124 Identity:30/124 - (24%)
Similarity:55/124 - (44%) Gaps:27/124 - (21%)


- Green bases have known domain annotations that are detailed below.


Human     1 MTGYTPDEKLRLQQLRELRRRWLKDQEL--SPRE-PVLPPQKMGPMEKFWNKFLENKSPWRKMVH 62
            :.|.:|:|       |..|::|||||||  .||: |.|..:...|:::|:...|:......:.|.
  Fly    28 LIGMSPEE-------RAWRKQWLKDQELHHGPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVL 85

Human    63 GVYK---------KSIFVFTHVLVPVWIIHYYMKYHVSE----KPYGIVEKKSRIFPGD 108
            |..:         |::...|.:....    ||.||:.::    ..:.::..:.:..|||
  Fly    86 GFQRAYTVRFWTGKALLALTGIYAGA----YYFKYNQNDWTRKGGWRVIHSRKQCVPGD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NDUFB6NP_002484.1 NDUF_B6 1..128 CDD:286822 30/124 (24%)
ND-B17NP_609765.1 NDUF_B6 9..160 CDD:286822 30/124 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4633
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.