DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and YTA6

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_015251.1 Gene:YTA6 / 856031 SGDID:S000005995 Length:754 Species:Saccharomyces cerevisiae


Alignment Length:328 Identity:93/328 - (28%)
Similarity:159/328 - (48%) Gaps:57/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EKAENSSL---------NLQGKSKG---KVVRQSIINPD---WDFGKMGIGGLDKEFNSIFRRAF 235
            |.:.:|||         ::||..:.   :::.:.::..:   |:    .|.||....||: :.|.
Yeast   428 ESSASSSLDSRKEDILKSVQGVDRNACEQILNEILVTDEKVYWE----DIAGLRNAKNSL-KEAV 487

  Fly   236 ASRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEA 300
            ......|:|.:.|. :.|:|:||:||||||||::|:.:.|..|:.... |:...:|.||:||||.
Yeast   488 VYPFLRPDLFKGLR-EPVRGMLLFGPPGTGKTMIAKAVATESNSTFFS-VSASSLLSKYLGESEK 550

  Fly   301 NVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGV---- 361
            .||.||..|    |:|.|:    ||..||||::...|......|.  ..:..:||.:...:    
Yeast   551 LVRALFYMA----KKLSPS----IIFIDEIDSMLTARSDNENESS--RRIKTELLIQWSSLSSAT 605

  Fly   362 ---DQLNN-----ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRM--RE 416
               :..||     :||:|.||....||:|..|  |...::.|.||:.:.|:    .|.||:  ::
Yeast   606 AQSEDRNNTLDSRVLVLGATNLPWAIDDAARR--RFSRKLYIPLPDYETRL----YHLKRLMAKQ 664

  Fly   417 FNKINDDVDNKEIAALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFL 481
            .|.: .|:|.:.|..:|:.|||::|..|.:.|....:..|  .|..:..|.:.:..:::.  ||.
Yeast   665 KNSL-QDLDYELITEMTEGFSGSDLTSLAKEAAMEPIRDL--GDKLMFADFDKIRGIEIK--DFQ 724

  Fly   482 HSL 484
            ::|
Yeast   725 NAL 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 80/257 (31%)
AAA 256..397 CDD:278434 52/152 (34%)
AAA 539..668 CDD:278434
YTA6NP_015251.1 SpoVK 201..747 CDD:223540 93/328 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.