DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and ATAD1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001308896.1 Gene:ATAD1 / 84896 HGNCID:25903 Length:361 Species:Homo sapiens


Alignment Length:376 Identity:97/376 - (25%)
Similarity:163/376 - (43%) Gaps:98/376 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LEAIDP--KSLGEGKDTAMRNVRFGRILGNTVVQFEKAENSSLNLQGKSKGKVVRQSIINP---- 211
            ::||||  |...|.:..|.:.:   :.:|...|:..:.|.|            :...:::|    
Human    38 VDAIDPTRKQKVEAQKQAEKLM---KQIGVKNVKLSEYEMS------------IAAHLVDPLNMH 87

  Fly   212 -DWDFGKMGIGGLDKEFNS-------------IFRRAFASRVFPPELVEQLGCKHVKGILLYGPP 262
             .|.    .|.|||.....             :|..   ||:..|.          ||:||||||
Human    88 VTWS----DIAGLDDVITDLKDTVILPIKKKHLFEN---SRLLQPP----------KGVLLYGPP 135

  Fly   263 GTGKTLMARQIGTMLNAREP--KIVN-GPQIL-DKYVGESEANVRRLFAEAEEEEKRLGPNSGLH 323
            |.||||:|:     ..|:|.  :.:| .|..| ||:.|||:.....:|:.|    .:|.|:    
Human   136 GCGKTLIAK-----ATAKEAGCRFINLQPSTLTDKWYGESQKLAAAVFSLA----IKLQPS---- 187

  Fly   324 IIIFDEIDAICKQRGSVAGNSGVHDTVV---NQLLTKIDGVDQLNN--ILVIGMTNRRDMIDEAL 383
            ||..||||:..:.|     :|..|:...   .|.::..||:|..::  ::|:|.|||...:|.|:
Human   188 IIFIDEIDSFLRNR-----SSSDHEATAMMKAQFMSLWDGLDTDHSCQVIVMGATNRPQDLDSAI 247

  Fly   384 LRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAA 448
            :|  |:..:..|:.|..:.|..||.:..|.    ..::..||..|:|..|..|||::|:.:.|.|
Human   248 MR--RMPTRFHINQPALKQREAILKLILKN----ENVDRHVDLLEVAQETDGFSGSDLKEMCRDA 306

  Fly   449 QSSAMNRLIKADAKVTVDPE------------AMEKLKVNRD-DFLHSLEH 486
            ....:...:.:.::.:.|.:            |:||:|.::| .|.:.|.|
Human   307 ALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQNVLTH 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 2/4 (50%)
SpoVK 242..699 CDD:223540 77/267 (29%)
AAA 256..397 CDD:278434 49/149 (33%)
AAA 539..668 CDD:278434
ATAD1NP_001308896.1 RecA-like_ATAD1 92..257 CDD:410928 58/197 (29%)
AAA_lid_3 282..321 CDD:407720 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.