DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and IQCA1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001257514.1 Gene:IQCA1 / 79781 HGNCID:26195 Length:830 Species:Homo sapiens


Alignment Length:427 Identity:90/427 - (21%)
Similarity:152/427 - (35%) Gaps:120/427 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 RDMIDEALLRPGRLEVQMEISLP-NEQGRVQILNIHTKRMREFN---KINDDVDNKEIAALTKNF 436
            :|...|.:....|.|:|.||.:. :|..|.::.|:.....||..   |.....|.|      |..
Human   424 QDYDPELIKEEKRKELQSEIRIQVDELMRQELKNLKLAVDRERERPVKAGKKKDKK------KGK 482

  Fly   437 SGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAM-EKLKVNRDDFLHSLEHDIKPAFGTAQEILD 500
            .|.:.|...:..:....:|.|::..|..|:...: :.||||..|::....:            |.
Human   483 KGKKKEKKAKKDKDLTADRTIESLYKELVEEGLLIQALKVNLSDYIGEYSY------------LG 535

  Fly   501 NMLARGVINWGAPVSNLLE-------DGMLYVQQAKAPESSGLV-SVLVAGAPNSGK-------- 549
            ..|.:..|.   |:.:||:       .|:..:..|...|.:.|| |:|:||....||        
Human   536 TTLRQVSIE---PMPSLLDVRQLITLYGIWPLGSAAVHEKAPLVKSLLLAGPSGVGKKMLVHAIC 597

  Fly   550 TALAAQLAKMSD------FPFVKVCSPEDMVGYTESAKCLHIRKIFDDAYRSMLSCIVVDNVERL 608
            |...|.|..:|.      :|           |.......||  .:|..|.:...|.:.:::.|:.
Human   598 TETGANLFNLSSSNIAGKYP-----------GKNGLQMMLH--AVFKVARQLQPSVVWIEDTEKT 649

  Fly   609 LDYGSI-------GPRYSNMTLQALLVLLKKQPPKGRKLLILCTSSRREVLEEMEMLTAFTSVLH 666
            . |..:       .|:.....|..:|.|||   |..| :||:.|:.|....|.......:..::.
Human   650 F-YKKVPNAEKMNEPKRLKKHLPQILKLLK---PDDR-ILIVGTTRRPFDAELQSFCKVYQKIIL 709

  Fly   667 VPNLSKPDH-----------------------VLAVLENTDIFSKGEIQAIGKKMAGKRVFIGIK 708
            ||   :||:                       |..:.:.||.|::|.|..:            :|
Human   710 VP---RPDYASRYVLWKQIIERNGGVLTSALNVSCLAKVTDGFTQGHIVEV------------VK 759

  Fly   709 KLLGLIDMARQTEQSQRAIKFLS---------KMEEE 736
            .:|....:.||..:...|::|::         |.|||
Human   760 GVLTDQRIRRQIHKPLTAVEFITAITSMNPVYKEEEE 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 80/379 (21%)
AAA 256..397 CDD:278434 7/20 (35%)
AAA 539..668 CDD:278434 31/149 (21%)
IQCA1NP_001257514.1 SpoVK <497..796 CDD:223540 70/346 (20%)
AAA 579..712 CDD:278434 33/153 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.