Sequence 1: | NP_001259506.1 | Gene: | comt / 47091 | FlyBaseID: | FBgn0000346 | Length: | 745 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001201840.1 | Gene: | Fignl2 / 668225 | MGIID: | 3646919 | Length: | 644 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 58/202 - (28%) |
---|---|---|---|
Similarity: | 95/202 - (47%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 256 ILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNS 320
Fly 321 GLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGV--DQLNNILVIGMTNRRDMIDEAL 383
Fly 384 LRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAAL---TKNFSGAELEGLV 445
Fly 446 RAAQSSA 452 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
comt | NP_001259506.1 | CDC48_N | 5..83 | CDD:215012 | |
CDC48_2 | 111..>158 | CDD:215011 | |||
SpoVK | 242..699 | CDD:223540 | 58/202 (29%) | ||
AAA | 256..397 | CDD:278434 | 38/142 (27%) | ||
AAA | 539..668 | CDD:278434 | |||
Fignl2 | NP_001201840.1 | SpoVK | <381..638 | CDD:223540 | 58/202 (29%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0464 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |