DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and Fignl1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_011242039.1 Gene:Fignl1 / 60530 MGIID:1890648 Length:692 Species:Mus musculus


Alignment Length:373 Identity:104/373 - (27%)
Similarity:156/373 - (41%) Gaps:83/373 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 VSQEPYDSDQMAKEFIMQFAGMALTVGQSLVFNFKDKKLLGLAVKSLEAIDPKSLGEGKDTAMRN 171
            ||.:...|:|.||:.....||.|...      :..|..|..:..:.:|.|..:.:..|..     
Mouse   362 VSNKQDGSEQHAKKHKSSRAGSAEPA------HLTDDCLKNVEPRMVELIMNEIMDHGPP----- 415

  Fly   172 VRFGRILGNTVVQFEKAENSSLNLQGKSKGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFA 236
            |.:..|.|   |:|.||          :..::|...::.||...|..|                 
Mouse   416 VHWDDIAG---VEFAKA----------TIKEIVVWPMMRPDIFTGLRG----------------- 450

  Fly   237 SRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEAN 301
                ||           |||||:|||||||||:.:.|.:...|....| :...:..|:|||.|..
Mouse   451 ----PP-----------KGILLFGPPGTGKTLIGKCIASQSGATFFSI-SASSLTSKWVGEGEKM 499

  Fly   302 VRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDT---VVNQLLTKIDG--V 361
            ||.|||.|..::..        :|..||||::..|||     .|.|::   :..:.|.::||  .
Mouse   500 VRALFAVARCQQPA--------VIFIDEIDSLLSQRG-----DGEHESSRRIKTEFLVQLDGATT 551

  Fly   362 DQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQIL-NIHTKRMREFNKINDDVD 425
            ...:.|||:|.|||...||||..|  ||..::.|.||....|.||: |:.:|.....:    |.:
Mouse   552 SSEDRILVVGATNRPQEIDEAARR--RLVKRLYIPLPEASARKQIVGNLMSKEQCCLS----DEE 610

  Fly   426 NKEIAALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKL 473
            ...:...:..||||::..|.|.|....:..|..||. .|:.|:.:..:
Mouse   611 TDLVVQQSDGFSGADMTQLCREASLGPIRSLHAADI-ATISPDQVRPI 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 11/46 (24%)
SpoVK 242..699 CDD:223540 77/238 (32%)
AAA 256..397 CDD:278434 54/145 (37%)
AAA 539..668 CDD:278434
Fignl1XP_011242039.1 RecA-like_Figl-1 398..583 CDD:410933 72/250 (29%)
AAA_lid_3 608..>639 CDD:407720 8/30 (27%)
Vps4_C <649..689 CDD:401324 1/9 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.