DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and fignl1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001122223.1 Gene:fignl1 / 569539 ZFINID:ZDB-GENE-030131-1862 Length:661 Species:Danio rerio


Alignment Length:356 Identity:97/356 - (27%)
Similarity:149/356 - (41%) Gaps:80/356 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 DKKLLGLAVKSLEAIDPKSLGEGKDTAMRNVRFGRILGNTVVQFEKAENSSLNLQGKSKGKVVRQ 206
            |::|.....|.:|.|..:.:..|...|..::        ..::|.||          :..::|..
Zfish   360 DERLKNFEPKIIELIMSEIMDHGPPVAWDDI--------AGLEFAKA----------TIKEIVVW 406

  Fly   207 SIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQLGCKHVKGILLYGPPGTGKTLMAR 271
            .::.||...|..|                     ||           |||||:|||||||||:.:
Zfish   407 PMLRPDIFTGLRG---------------------PP-----------KGILLFGPPGTGKTLIGK 439

  Fly   272 QIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQ 336
            .|.....|....| :...:..|:|||.|..||.|||.|...:..        :|..||||::..|
Zfish   440 CIACQSGATFFSI-SASSLTSKWVGEGEKMVRALFAIARCHQPA--------VIFIDEIDSLLSQ 495

  Fly   337 RGSVAGNSGVHDT---VVNQLLTKIDG--VDQLNNILVIGMTNRRDMIDEALLRPGRLEVQMEIS 396
            |     ..|.||:   :..:.|.::||  ....:.|||:|.|||...||||..|  ||..::.|.
Zfish   496 R-----TDGEHDSSRRIKTEFLVQLDGAATSAEDRILVVGATNRPQEIDEAARR--RLAKRLYIP 553

  Fly   397 LPNEQGRVQILNIHTKRMREFNKINDDVDNKE-IAALTKNFSGAELEGLVRAAQSSAMNRLIKAD 460
            ||..:.|.||:.    .:....|....||..| :...|:.||||::..|.|.|....:..:..:|
Zfish   554 LPEAEARRQIVT----NLMSHEKSQLGVDEMEKVVQGTEGFSGADMTQLCREAALGPIRSISLSD 614

  Fly   461 AKVTVDPEAMEKLKVNRDDFLHSLEHDIKPA 491
            . .|:..|.:..:..:  ||..:|: .::|:
Zfish   615 I-ATIMAEQVRPILYS--DFQEALK-TVRPS 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 5/15 (33%)
SpoVK 242..699 CDD:223540 81/256 (32%)
AAA 256..397 CDD:278434 54/145 (37%)
AAA 539..668 CDD:278434
fignl1NP_001122223.1 AAA 420..556 CDD:214640 59/162 (36%)
AAA 424..554 CDD:278434 54/145 (37%)
Vps4_C <610..658 CDD:286426 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.