DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and fignl2

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001201837.1 Gene:fignl2 / 561837 ZFINID:ZDB-GENE-090313-189 Length:684 Species:Danio rerio


Alignment Length:458 Identity:90/458 - (19%)
Similarity:164/458 - (35%) Gaps:147/458 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LQKK----TVSQEPYDSDQMAKEFIMQFAGMALTVGQSLVFNFKDKKLLGLAVKSLEAIDPKSLG 162
            |::|    |:.:|..||.:..|     ::...:..|....:...||...|....|   .||:...
Zfish   283 LKRKAFEMTLDEEDSDSSRYRK-----YSYDPMKTGGDSPYGVTDKAGNGFGTGS---TDPQGFK 339

  Fly   163 EGKDTAMRNVRFGRILGNTVVQFEKAENSSLNLQGKSKGKVV-RQSIINPDWDFGKMG------- 219
            ..|                       .:|..:|:|...||.. .:.:::|  .:|..|       
Zfish   340 PSK-----------------------PSSQSSLEGDEVGKYSGLKPLVSP--TYGAAGDYSPPAA 379

  Fly   220 ----IGGLDKEF--NSIFRRAFASRVFPPELVEQL-----------------GCKHVKG------ 255
                .||.::.|  |...:|:...:...|.::|.:                 |..|:|.      
Zfish   380 MTGENGGAEQGFSQNRSQKRSDPMKSIEPRMLELVSRELQDCSPAMLWTELAGNCHIKAALEEDL 444

  Fly   256 ----------------ILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRR 304
                            |||:||.|.|||.:||.:.:.:.|...:: :...:..|..||:|..:..
Zfish   445 LWPVLRPNPAIHPPKTILLFGPQGGGKTTLARSLSSQIGASFYRL-SCATLASKLKGEAEQLLLT 508

  Fly   305 LFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGV--DQLNNI 367
            ||:.|...:..:        ::..|::|| ::.|           :..||..:::.:  :|.|..
Zfish   509 LFSVATARQPAM--------VLLSEVEAI-EEEG-----------LRQQLQAQLEKIQHNQSNQF 553

  Fly   368 LVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAAL 432
            ||:..|.|.|:|.::|||  ....:..|.||:...|..:|      ::........:..:|::|:
Zfish   554 LVVCTTRRPDLIKDSLLR--CFSKRYHIGLPDGNTRRHVL------LQALAPQGCSLSERELSAV 610

  Fly   433 TKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLE--------HDIK 489
            .:...|..:..|::..|.:    |..|.|..:|.              ||||.        .|.:
Zfish   611 LQRSEGFSVWELLQLCQQA----LASASASASVP--------------LHSLPASLSSPTLQDFE 657

  Fly   490 PAF 492
            .||
Zfish   658 NAF 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011 8/46 (17%)
SpoVK 242..699 CDD:223540 62/300 (21%)
AAA 256..397 CDD:278434 37/142 (26%)
AAA 539..668 CDD:278434
fignl2NP_001201837.1 AAA 457..583 CDD:214640 38/148 (26%)
AAA 461..581 CDD:278434 37/142 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.