DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and iqca1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_009300551.1 Gene:iqca1 / 553364 ZFINID:ZDB-GENE-050208-768 Length:845 Species:Danio rerio


Alignment Length:521 Identity:92/521 - (17%)
Similarity:187/521 - (35%) Gaps:134/521 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 QILDKYVGESEANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTV--- 350
            |:..::..:.|...::...::|:::|              ..|...|::|...|..|..||.   
Zfish   334 QVAAEFAAKEEEREKKKKLKSEKDKK--------------ANDRKEKKKGKPKGKGGKGDTEEEE 384

  Fly   351 -------VNQLLTKIDGV----------DQLNNILVIGMTNRRDMIDEALLR-PGRLEVQMEISL 397
                   .|.|.|...|.          |:..|.|        ...|..|:| ..||||::|:  
Zfish   385 TGWKMTHSNFLPTVFKGAKLYKEVWQNRDEQQNFL--------QRFDAQLVREEKRLEVEVEL-- 439

  Fly   398 PNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNFSGAELEGLVRAAQSSAMNRLIKAD-- 460
                 |||:..:..:.::....:.|....|:...:.|:....:.:|.....:.....:.:.||  
Zfish   440 -----RVQVDELMRQELKNLKLVVDRDKGKKKKKVKKSSKKKKKKGRKTGKKKKKKEKDLTADRT 499

  Fly   461 -----AKVTVDPEAMEKLKVNRDDFLHSLEH--------DIKPAFGTAQEILDNMLARGVINWGA 512
                 .::.::...:..:.|...|::....:        ||:| ..:..::...:...|::..|:
Zfish   500 IESLYEELVLEGIIIRPMNVKLSDYIGEYSYLGTTLRQADIEP-MPSLSDVRQLIALYGILPLGS 563

  Fly   513 PVSNLLEDGMLYVQQAKAPESSGLVSVLVAGAPNSGKTALAAQLAKMSDFPFVKVCSPEDMVG-Y 576
            ...:  |.|.|            :.::|:.|....||..|...|...:......: ||..:.| |
Zfish   564 QCVH--ERGPL------------IRALLLTGPQGVGKKMLVHALCTETGANLFNL-SPSTLAGKY 613

  Fly   577 T-ESAKCLHIRKIFDDAYRSMLSCIVVDNVERLLDYGSI-------GPRYSNMTLQALLVLLKKQ 633
            . :|...|.:..:|..|.:...|.|.:.:.|:.. |..:       .|:....||..:|..:|.:
Zfish   614 PGKSGLQLLLHMVFKVARQLQPSVIWIGDAEKTF-YKKVPKLEKEMEPKRLKKTLPKILKSIKAE 677

  Fly   634 PPKGRKLLILCTSSRREVLEEMEMLTAFTSVLHVPNLSKPDH----------------------- 675
            .    ::|::.||.|....:.......:..::.:|   :||:                       
Zfish   678 D----RVLVVGTSRRPFDADIKPFCKVYKKIILIP---RPDYASRFTLWKELLQAHGALLDPKLD 735

  Fly   676 VLAVLENTDIFSKGEI-QAIGKKMAGKRVFIGIKKLLGLID----MARQTEQSQRAIKFLSKMEE 735
            :.::.:.||.:::|.| |||...:...|:.:..|:.|..::    :|||..        :.|.||
Zfish   736 LSSLAKVTDGYTQGHILQAIQTILIPHRLELQAKRPLTAVEFIPPLARQDP--------VYKEEE 792

  Fly   736 E 736
            |
Zfish   793 E 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 82/478 (17%)
AAA 256..397 CDD:278434 26/128 (20%)
AAA 539..668 CDD:278434 27/137 (20%)
iqca1XP_009300551.1 SpoVK <576..748 CDD:223540 32/180 (18%)
AAA 576..691 CDD:278434 27/120 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.