DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and FIGN

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_011509691.1 Gene:FIGN / 55137 HGNCID:13285 Length:785 Species:Homo sapiens


Alignment Length:333 Identity:88/333 - (26%)
Similarity:146/333 - (43%) Gaps:63/333 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EKAENSSLNLQGKSKGKVVRQSIINP--DWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELVEQL 248
            |:.:|:..:|......:::.|   .|  ||:    .|.|||     :.:......|..|.|....
Human   485 EQLKNTDTHLIDLVTNEIITQ---GPPVDWN----DIAGLD-----LVKAVIKEEVLWPVLRSDA 537

  Fly   249 --GCKHV-KGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLFAEAE 310
              |...: :.|||:||.||||||:.|.|.:.|.|...||. |..::.|::||:|..:...|..|.
Human   538 FSGLTALPRSILLFGPRGTGKTLLGRCIASQLGATFFKIA-GSGLVAKWLGEAEKIIHASFLVAR 601

  Fly   311 EEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVV---NQLLTKIDGV-----DQLNNI 367
            ..:    |:    :|...:||.:...:.:..     |..|.   .:.|.::|.|     ||   |
Human   602 CRQ----PS----VIFVSDIDMLLSSQVNEE-----HSPVSRMRTEFLMQLDTVLTSAEDQ---I 650

  Fly   368 LVIGMTNRRDMIDEALLR--PGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIA 430
            :||..|::.:.|||:|.|  ..||.:.:..|....|..||:|:.|          |..:::||.|
Human   651 VVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLSQH----------NYCLNDKEFA 705

  Fly   431 AL---TKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAF 492
            .|   |:.|||.::..|.:.|....::.:...|.. .:.|..:.  .|...||.::. ..|:|:.
Human   706 LLVQRTEGFSGLDVAHLCQEAVVGPLHAMPATDLS-AIMPSQLR--PVTYQDFENAF-CKIQPSI 766

  Fly   493 GTAQEILD 500
              :|:.||
Human   767 --SQKELD 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 76/275 (28%)
AAA 256..397 CDD:278434 46/150 (31%)
AAA 539..668 CDD:278434
FIGNXP_011509691.1 AAA 545..680 CDD:214640 46/151 (30%)
AAA 548..678 CDD:278434 46/146 (32%)
Vps4_C <749..782 CDD:286426 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.