DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and spast

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:XP_012818464.1 Gene:spast / 549207 XenbaseID:XB-GENE-947839 Length:603 Species:Xenopus tropicalis


Alignment Length:251 Identity:83/251 - (33%)
Similarity:133/251 - (52%) Gaps:32/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 PELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKIVNGPQILDKYVGESEANVRRLF 306
            |||...|... .:|:||:||||.|||::|:.:....||....| :...:..|||||.|..||.||
 Frog   352 PELFTGLRAP-ARGLLLFGPPGNGKTMLAKAVAAESNATFFNI-SAASLTSKYVGEGEKLVRALF 414

  Fly   307 AEAEEEEKRLGPNSGLHIIIFDEIDA-ICKQRGSVAGNSGVHDT---VVNQLLTKIDGVDQ--LN 365
            :.|.|    |.|:    ||..||:|: :|::|      .|.||.   :..:.|.:.|||..  .:
 Frog   415 SVARE----LQPS----IIFIDEVDSLLCERR------EGEHDASRRLKTEFLIEFDGVQSGGDD 465

  Fly   366 NILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQIL-NIHTKRMREFNKINDDVDNKEI 429
            .:||:|.|||...:|:|:||  |...::.:|||||:.|:.:| |:.:|   :.|.:|:. :..::
 Frog   466 RVLVMGATNRPQELDDAVLR--RFTKRVYVSLPNEETRLLLLKNLLSK---QGNPLNEK-ELTQL 524

  Fly   430 AALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLE 485
            :.||:.:||:::..|.:.|....:..|.....|   :..|.|...:...|||.||:
 Frog   525 SRLTEGYSGSDITALAKDAALGPIRELKPEQVK---NMAASEMRNIKYSDFLSSLK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 83/251 (33%)
AAA 256..397 CDD:278434 52/146 (36%)
AAA 539..668 CDD:278434
spastXP_012818464.1 MIT_spastin 110..188 CDD:239142
SpoVK <278..584 CDD:223540 83/251 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.