DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and PEX6

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_000278.3 Gene:PEX6 / 5190 HGNCID:8859 Length:980 Species:Homo sapiens


Alignment Length:330 Identity:99/330 - (30%)
Similarity:168/330 - (50%) Gaps:50/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GNTVVQFEKAENSSLNLQGKSKGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFP-- 241
            |..:.|.:.|.:.::   |..|       |.:..|.    .:|||.:    :.:....:...|  
Human   680 GQALEQLQTAHSQAV---GAPK-------IPSVSWH----DVGGLQE----VKKEILETIQLPLE 726

  Fly   242 -PELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI----VNGPQILDKYVGESEAN 301
             |||: .||.:. .|:||:|||||||||:|:.:.|     |..:    |.||::::.|||:||.|
Human   727 HPELL-SLGLRR-SGLLLHGPPGTGKTLLAKAVAT-----ECSLTFLSVKGPELINMYVGQSEEN 784

  Fly   302 VRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQLNN 366
            ||.:||.|    :...|    .||.|||:|::...||....:.||.|.||:|||.::||:....:
Human   785 VREVFARA----RAAAP----CIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQD 841

  Fly   367 ILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQ-GRVQILNIHTKRMREFNKINDDVDNKEIA 430
            :.|||.|||.|::|.|||||||.:..:.:....:: .::::|:..|::.    |:...|....:.
Human   842 VFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKF----KLEPSVSLVNVL 902

  Fly   431 -ALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFLHSLEHDIKPAFGT 494
             ......:||:|..|...|.::|:.|.:. |.:..::| ....|.:..:|.|.:... ::|:. :
Human   903 DCCPPQLTGADLYSLCSDAMTAALKRRVH-DLEEGLEP-GSSALMLTMEDLLQAAAR-LQPSV-S 963

  Fly   495 AQEIL 499
            .||:|
Human   964 EQELL 968

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 88/264 (33%)
AAA 256..397 CDD:278434 62/144 (43%)
AAA 539..668 CDD:278434
PEX6NP_000278.3 SpoVK 463..967 CDD:223540 97/327 (30%)
AAA 466..594 CDD:278434
AAA 743..871 CDD:278434 60/140 (43%)
Vps4_C 918..977 CDD:286426 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.