DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and PEX1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_000457.1 Gene:PEX1 / 5189 HGNCID:8850 Length:1283 Species:Homo sapiens


Alignment Length:453 Identity:140/453 - (30%)
Similarity:215/453 - (47%) Gaps:72/453 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 RILGNTVVQFEKAENSSLNLQGKSKGKV---VRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFAS 237
            |:...::...||...::|:.|...:|.:   :|...::...|.|...|||| .|...|.......
Human   795 RLSRQSISTREKLVLTTLDFQKALRGFLPASLRSVNLHKPRDLGWDKIGGL-HEVRQILMDTIQL 858

  Fly   238 RVFPPELVEQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI----VNGPQILDKYVGES 298
            ....|||...|..:...||||||||||||||:|..|     |||.::    |.||::|.||:|.|
Human   859 PAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVI-----ARESRMNFISVKGPELLSKYIGAS 918

  Fly   299 EANVRRLFAEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQ 363
            |..||.:|..|:..:.        .|:.|||.::|..:||.  .|:||.|.|||||||::|||:.
Human   919 EQAVRDIFIRAQAAKP--------CILFFDEFESIAPRRGH--DNTGVTDRVVNQLLTQLDGVEG 973

  Fly   364 LNNILVIGMTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKE 428
            |..:.|:..|:|.|:||.||||||||:..:....|::..|::|||:    :.:...:.||||.:.
Human   974 LQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNV----LSDSLPLADDVDLQH 1034

  Fly   429 IAALTKNFSGAELEGLVRAAQSSAMNRLIKADAKVTVDPEAMEKLKVNRDDFL-HSLEHDIKPAF 492
            :|::|.:|:||:|:.|:..||..|::.::.:.........:...|.::...|| ||...|  .:.
Human  1035 VASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLSLSSMVFLNHSSGSD--DSA 1097

  Fly   493 GTAQEILDNMLARGVINWGAPVSNLLED-----------GMLYVQQAKAPESSGLVSVLVAGAPN 546
            |..:..||..|.      ...:|.:|.|           |..|..:.....||.|.|..:: ||:
Human  1098 GDGECGLDQSLV------SLEMSEILPDESKFNMYRLYFGSSYESELGNGTSSDLSSQCLS-APS 1155

  Fly   547 S---------GKTALAAQLAKMSDFPFVKVCSPEDMVGYTESAKCLHIRKIFDDAYRSMLSCI 600
            |         ||..|.:|.      |.::..|.|.....|:..:         |..|:.:|.|
Human  1156 SMTQDLPGVPGKDQLFSQP------PVLRTASQEGCQELTQEQR---------DQLRADISII 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 125/384 (33%)
AAA 256..397 CDD:278434 67/144 (47%)
AAA 539..668 CDD:278434 15/71 (21%)
PEX1NP_000457.1 PEX-2N 19..98 CDD:286362
PEX-1N 104..179 CDD:286361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..367
SpoVK 595..1063 CDD:223540 106/287 (37%)
AAA 595..731 CDD:278434
AAA 877..1006 CDD:278434 67/143 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1260..1283
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.