DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comt and Pex1

DIOPT Version :9

Sequence 1:NP_001259506.1 Gene:comt / 47091 FlyBaseID:FBgn0000346 Length:745 Species:Drosophila melanogaster
Sequence 2:NP_001102690.1 Gene:Pex1 / 500006 RGDID:1559939 Length:1283 Species:Rattus norvegicus


Alignment Length:443 Identity:140/443 - (31%)
Similarity:208/443 - (46%) Gaps:72/443 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 TVVQFEKAENSSLNLQGKSKGKVVRQSIINPDWDFGKMGIGGLDKEFNSIFRRAFASRVFPPELV 245
            |...|:||      |:|.....:...::..|. |.|...|||| .|...|...........|||.
  Rat   810 TTADFQKA------LRGFLPASLRNVNLHKPR-DLGWDKIGGL-HEVRQILMDTIQLPAKYPELF 866

  Fly   246 EQLGCKHVKGILLYGPPGTGKTLMARQIGTMLNAREPKI----VNGPQILDKYVGESEANVRRLF 306
            ..|..:...||||||||||||||:|..:     |||..:    :.||::|.||:|.||..||.:|
  Rat   867 ANLPIRQRTGILLYGPPGTGKTLLAGVV-----ARESGMNFISIQGPELLSKYIGASEQAVRDVF 926

  Fly   307 AEAEEEEKRLGPNSGLHIIIFDEIDAICKQRGSVAGNSGVHDTVVNQLLTKIDGVDQLNNILVIG 371
            ..|:..:.        .|:.|||.::|..:||.  .|:||.|.|||||||::|||:.|..:.|:.
  Rat   927 IRAQAAKP--------CILFFDEFESIAPRRGH--DNTGVTDRVVNQLLTQLDGVEGLQGVYVLA 981

  Fly   372 MTNRRDMIDEALLRPGRLEVQMEISLPNEQGRVQILNIHTKRMREFNKINDDVDNKEIAALTKNF 436
            .|:|.|:||.||||||||:..:....|::..|::||.:.:|.:    .:.||||.:.:|::|::|
  Rat   982 ATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILTVLSKSL----PLADDVDLQHVASVTESF 1042

  Fly   437 SGAELEGLVRAAQSSAM-NRLIKA---DAKVTVDPEAMEKLKVNRDDFL-HSLEHDIKPAFGTAQ 496
            :||:|:.|:..||..|: .||:..   |...:.|.:    |.::...|| ||...|  .:.|..:
  Rat  1043 TGADLKALLYNAQLEALQGRLLPGGLHDGGSSSDSD----LSLSSMVFLNHSSGSD--DSAGDGE 1101

  Fly   497 EILDNMLARGVINWGAPVSNLLED-----------GMLYVQQAKAPESSGLVSVLVAGAPNSGKT 550
            ..||..|.      ...:|.:|.|           |..|..:.....|..|.|..:: ||:|...
  Rat  1102 CGLDQSLV------SLEMSEILPDESKFNMYRLYFGSSYESELGNGASCDLSSHCLS-APSSMTQ 1159

  Fly   551 ALAAQLAK---MSDFPFVKVCSPEDMVGYTESAKCLHIRKIFDDAYRSMLSCI 600
            .|.|...|   .:..|..:..|.|.....|:..:         |..|:.:|.|
  Rat  1160 DLPATPGKDPLFTQHPVFRTPSQEGSQDLTQEQR---------DQLRADISII 1203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comtNP_001259506.1 CDC48_N 5..83 CDD:215012
CDC48_2 111..>158 CDD:215011
SpoVK 242..699 CDD:223540 125/382 (33%)
AAA 256..397 CDD:278434 65/144 (45%)
AAA 539..668 CDD:278434 14/65 (22%)
Pex1NP_001102690.1 PEX-2N 19..98 CDD:286362
PEX-1N 104..179 CDD:286361
AAA 591..741 CDD:214640
AAA 595..724 CDD:278434
AAA 877..1009 CDD:214640 65/146 (45%)
AAA 877..1006 CDD:278434 65/143 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.